SFTPD/SP-D/SFTP4 Active Protein | SFTPD active protein

Recombinant Human SFTPD/SP-D/SFTP4 Protein

Cat. Num. AAA9139714

• Gene Names: SFTPD; SP-D; PSP-D; SFTP4; COLEC7
• Purity: >97% by SDS-PAGE.
• Synonyms: SFTPD/SP-D/SFTP4; Recombinant Human SFTPD/SP-D/SFTP4 Protein; COLEC7; PSP-D; SFTP4; SP-D; SFTPD active protein

• Host: HEK293 Cells
• Purity/Purification: >97% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
• Sequence Length: 375

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its ability to bind fluorescein-conjugated E. coli Bioparticles. The ED50 for this effect is 0.5-3 ug/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human SFTPD/SP-D/SFTP4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 40-50 kDa.)

Related Product Information for SFTPD active protein

Description: Recombinant Human SFTPD/SP-D/SFTP4 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala21-Phe375 (Glu22Gly)) of human SFTPD/SP-D/SFTP4 (Accession #NP_003010.4) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism.

Product Categories/Family for SFTPD active protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 61699226
• NCBI GeneID: 6441
• NCBI Accession #: NP_003010.4
• NCBI GenBank Nucleotide #: NP_003010.4
• UniProt Accession #: P35247
• NCBI Official Full Name: pulmonary surfactant-associated protein D
• NCBI Official Synonym Full Names: surfactant protein D
• NCBI Official Symbol: SFTPD
• NCBI Official Synonym Symbols: SP-D; PSP-D; SFTP4; COLEC7
• NCBI Protein Information: pulmonary surfactant-associated protein D
• UniProt Protein Name: Pulmonary surfactant-associated protein D
• Protein Family: Pulmonary surfactant-associated protein
• UniProt Gene Name: SFTPD
• UniProt Synonym Gene Names: COLEC7; PSPD; SFTP4; PSP-D; SP-D
• UniProt Entry Name: SFTPD_HUMAN

NCBI Description

The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism. [provided by RefSeq, Jul 2015]

Uniprot Description

SFTPD: Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. Belongs to the SFTPD family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q22.2-q23.1

Cellular Component: extracellular space; proteinaceous extracellular matrix; collagen; lysosome; endocytic vesicle; extracellular region

Molecular Function: protein binding; carbohydrate binding

Biological Process: receptor-mediated endocytosis; negative regulation of T cell proliferation; positive regulation of phagocytosis; negative regulation of interleukin-2 biosynthetic process; defense response to bacterium; innate immune response; respiratory gaseous exchange; surfactant homeostasis; macrophage chemotaxis; alveolus development; regulation of cytokine production