Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Granulin/GRN/Progranulin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 90-95 kDa.)

Granulin/GRN/Progranulin Active Protein | GRN active protein

Recombinant Human Granulin/GRN/Progranulin Protein

Gene Names
GRN; GEP; GP88; PEPI; PGRN; CLN11; PCDGF
Purity
>90% by SDS-PAGE.
Synonyms
Granulin/GRN/Progranulin; Recombinant Human Granulin/GRN/Progranulin Protein; CLN11; GEP; GP88; Granulin; PCDGF; PEPI; PGRN; Progranulin; GRN active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Sequence Length
593
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Recombinant Human Granulin / GRN / Progranulin, immobilized at 10-40 ug/mL on a nitrocellulose coated plate, is able to significantly enhance neurite outgrowth.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Granulin/GRN/Progranulin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 90-95 kDa.)

SDS-Page (Recombinant Human Granulin/GRN/Progranulin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 90-95 kDa.)
Related Product Information for GRN active protein
Description: Recombinant Human Granulin/GRN/Progranulin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr18-Leu593) of human Granulin/GRN/Progranulin (Accession #NP_002078.1) fused with a 6xHis tag at the C-terminus.

Background: Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.
Product Categories/Family for GRN active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
granulin
NCBI Official Synonym Full Names
granulin precursor
NCBI Official Symbol
GRN
NCBI Official Synonym Symbols
GEP; GP88; PEPI; PGRN; CLN11; PCDGF
NCBI Protein Information
progranulin
UniProt Protein Name
Granulins
Protein Family
UniProt Gene Name
GRN
UniProt Synonym Gene Names
PEPI
UniProt Entry Name
GRN_HUMAN

NCBI Description

Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

GRN: Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling. Defects in GRN are the cause of ubiquitin-positive frontotemporal dementia (UP-FTD); also known as tau- negative frontotemporal dementia linked to chromosome 17. Frontotemporal dementia (FTD) is the second most common cause of dementia in people under the age of 65 years. It is an autosomal dominant neurodegenerative disease. Defects in GRN are the cause of neuronal ceroid lipofuscinosis type 11 (CLN11). A form of neuronal ceroid lipofuscinosis characterized by rapidly progressive visual loss due to retinal dystrophy, seizures, cerebellar ataxia, and cerebellar atrophy. Cognitive decline may also occur. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material. Belongs to the granulin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: extracellular space; mitochondrion; intracellular membrane-bound organelle

Molecular Function: protein binding; growth factor activity; cytokine activity

Biological Process: blastocyst hatching; signal transduction; positive regulation of epithelial cell proliferation; embryo implantation

Disease: Frontotemporal Lobar Degeneration With Tdp43 Inclusions, Grn-related; Ceroid Lipofuscinosis, Neuronal, 11

Research Articles on GRN

Similar Products

Product Notes

The GRN grn (Catalog #AAA9141692) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TRCPDGQFCP VACCLDPGGA SYSCCRPLLD KWPTTLSRHL GGPCQVDAHC SAGHSCIFTV SGTSSCCPFP EAVACGDGHH CCPRGFHCSA DGRSCFQRSG NNSVGAIQCP DSQFECPDFS TCCVMVDGSW GCCPMPQASC CEDRVHCCPH GAFCDLVHTR CITPTGTHPL AKKLPAQRTN RAVALSSSVM CPDARSRCPD GSTCCELPSG KYGCCPMPNA TCCSDHLHCC PQDTVCDLIQ SKCLSKENAT TDLLTKLPAH TVGDVKCDME VSCPDGYTCC RLQSGAWGCC PFTQAVCCED HIHCCPAGFT CDTQKGTCEQ GPHQVPWMEK APAHLSLPDP QALKRDVPCD NVSSCPSSDT CCQLTSGEWG CCPIPEAVCC SDHQHCCPQG YTCVAEGQCQ RGSEIVAGLE KMPARRASLS HPRDIGCDQH TSCPVGQTCC PSLGGSWACC QLPHAVCCED RQHCCPAGYT CNVKARSCEK EVVSAQPATF LARSPHVGVK DVECGEGHFC HDNQTCCRDN RQGWACCPYR QGVCCADRRH CCPAGFRCAA RGTKCLRREA PRWDAPLRDP ALRQLL. It is sometimes possible for the material contained within the vial of "Granulin/GRN/Progranulin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.