FGFR3/CD333 active protein

Recombinant Human FGFR3/CD333 Protein

Cat. Num. AAA9141696

• Gene Names: FGFR3; ACH; CEK2; JTK4; CD333; HSFGFR3EX
• Purity: >90% by SDS-PAGE.
• Synonyms: FGFR3/CD333; Recombinant Human FGFR3/CD333 Protein; ACH; CD333; CEK2; HSFGFR3EX; JTK4; FGFR3/CD333 active protein

• Host: HEK293 Cells
• Purity/Purification: >90% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
• Sequence Length: 806

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its ability to inhibit FGF acidic-dependent proliferation of NR6R-3T3 mouse fibroblast cells. The ED50 for this effect is 1-3 ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: Fc, 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human FGFR3/CD333 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 95-105 kDa.)

Related Product Information for FGFR3/CD333 active protein

Description: Recombinant Human FGFR3/CD333 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu23-Gly375) of human FGFR3/CD333 (Accession #NP_000133.1) fused with an Fc, 6xHis tag at the C-terminus.

Background: FGFR3, also known as CD333, is a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. FGFRs are transmembrane catalytic receptors that have intracellular tyrosine kinase activity. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia.

Product Categories/Family for FGFR3/CD333 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4503711
• NCBI GeneID: 2261
• NCBI Accession #: NP_000133.1
• NCBI GenBank Nucleotide #: NP_000133.1
• UniProt Accession #: P22607
• NCBI Official Full Name: fibroblast growth factor receptor 3 isoform 1
• NCBI Official Synonym Full Names: fibroblast growth factor receptor 3
• NCBI Official Symbol: FGFR3
• NCBI Official Synonym Symbols: ACH; CEK2; JTK4; CD333; HSFGFR3EX
• NCBI Protein Information: fibroblast growth factor receptor 3
• UniProt Protein Name: Fibroblast growth factor receptor 3
• UniProt Gene Name: FGFR3
• UniProt Synonym Gene Names: JTK4; FGFR-3
• UniProt Entry Name: FGFR3_HUMAN

NCBI Description

This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. [provided by RefSeq, Aug 2017]

Uniprot Description

FGFR3: a receptor tyrosine kinase of the highly-conserved FGFR family that binds fibroblast growth factor (FGF). Mutations are associated with thanatophoric dysplasia (TD), craniosynostosis Adelaide type, many craniosynostotic syndromes and bone malformations. Three splice-variant isoforms have been described. Activating point mutations cause dwarfism, including achondroplasia, hypochrondroplasia and thanatophoric dysplasia, and facial and other morphogenetic disorders, including Crouzon syndrome, craniosynostosis Adelaide type, San Diego skeletal displasia and Muenke syndrome. Translocations t(4;14) involving the IgH region are common in multiple myeloma and frequently involve FGFR3. Activated FGFR3 found in 30% of bladder cancers and several cervical cancers, but not in other tumors. Two mutations found in colorectal cancer.

Protein type: Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; Membrane protein, integral; EC 2.7.10.1; TK group; FGFR family

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: Golgi apparatus; internal side of plasma membrane; transport vesicle; focal adhesion; cell surface; perinuclear region of cytoplasm; integral to plasma membrane; endoplasmic reticulum; lysosome; extracellular region; plasma membrane; nucleus

Molecular Function: protein binding; fibroblast growth factor binding; fibroblast growth factor receptor activity; protein-tyrosine kinase activity; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation; nerve growth factor receptor signaling pathway; somatic stem cell maintenance; protein amino acid autophosphorylation; negative regulation of transcription from RNA polymerase II promoter; bone mineralization; positive regulation of tyrosine phosphorylation of Stat3 protein; substantia nigra development; inner ear receptor cell differentiation; positive regulation of MAPKKK cascade; cell-cell signaling; positive regulation of neuron apoptosis; forebrain development; positive regulation of cell proliferation; morphogenesis of an epithelium; chondrocyte differentiation; response to axon injury; skeletal development; negative regulation of epithelial cell proliferation; endochondral ossification; epidermal growth factor receptor signaling pathway; negative regulation of developmental growth; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; myelination in the central nervous system; MAPKKK cascade; positive regulation of phosphoinositide 3-kinase activity; digestive tract morphogenesis; JAK-STAT cascade; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of protein ubiquitination; negative regulation of smoothened signaling pathway; negative regulation of mitosis; negative regulation of astrocyte differentiation; insulin receptor signaling pathway; innate immune response; positive regulation of endothelial cell proliferation; lens morphogenesis in camera-type eye; positive regulation of cell differentiation

Disease: Bladder Cancer; Achondroplasia; Hypochondroplasia; Muenke Syndrome; Achondroplasia, Severe, With Developmental Delay And Acanthosis Nigricans; Cervical Cancer; Thanatophoric Dysplasia, Type I; Crouzon Syndrome With Acanthosis Nigricans; Colorectal Cancer; Lacrimoauriculodentodigital Syndrome; Camptodactyly, Tall Stature, And Hearing Loss Syndrome; Thanatophoric Dysplasia, Type Ii; Testicular Germ Cell Tumor; Nevus, Epidermal