Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CD33/Siglec-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)

CD33/Siglec-3 Active Protein | CD33 active protein

Recombinant Human CD33/Siglec-3 Protein

Gene Names
CD33; p67; SIGLEC3; SIGLEC-3
Purity
>97% by SDS-PAGE.
Synonyms
CD33/Siglec-3; Recombinant Human CD33/Siglec-3 Protein; p67; Siglec-3; SIGLEC3; CD33 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Sequence Length
364
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD33 at 2 ug/mL (100 uL/well) can bind Anti-Human CD33 Antibody with a linear range of 8-20 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD33/Siglec-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)

SDS-Page (Recombinant Human CD33/Siglec-3 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-90 kDa.)
Related Product Information for CD33 active protein
Description: Recombinant Human CD33/Siglec-3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp18-His259) of human CD33/Siglec-3 (Accession #NP_001763.3) fused with an Fc, 6xHis tag at the C-terminus.

Background: Myeloid cell surface antigen CD33 also known as Sialic acid binding Ig-like lectin 3, CD33 antigen or Siglec-3, is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. This Single-pass type I membrane protein contains 1 Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. CD33/Siglec-3 induces apoptosis in acute myeloid leukemia (in vitro). CD33/Siglec-3 can function as a sialic acid-dependent cell adhesion molecule and that binding can be modulated by endogenous sialoglycoconjugates when CD33 is expressed in a plasma membrane.
Product Categories/Family for CD33 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
945
UniProt Accession #
NCBI Official Full Name
Myeloid cell surface antigen CD33
NCBI Official Synonym Full Names
CD33 molecule
NCBI Official Symbol
CD33
NCBI Official Synonym Symbols
p67; SIGLEC3; SIGLEC-3
NCBI Protein Information
myeloid cell surface antigen CD33
UniProt Protein Name
Myeloid cell surface antigen CD33
UniProt Gene Name
CD33
UniProt Synonym Gene Names
SIGLEC3; Siglec-3
UniProt Entry Name
CD33_HUMAN

Uniprot Description

CD33: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; receptor activity; carbohydrate binding

Biological Process: negative regulation of cell proliferation; cell-cell signaling; signal transduction; cell adhesion

Research Articles on CD33

Similar Products

Product Notes

The CD33 cd33 (Catalog #AAA9141711) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DPNFWLQVQE SVTVQEGLCV LVPCTFFHPI PYYDKNSPVH GYWFREGAII SRDSPVATNK LDQEVQEETQ GRFRLLGDPS RNNCSLSIVD ARRRDNGSYF FRMERGSTKY SYKSPQLSVH VTDLTHRPKI LIPGTLEPGH SKNLTCSVSW ACEQGTPPIF SWLSAAPTSL GPRTTHSSVL IITPRPQDHG TNLTCQVKFA GAGVTTERTI QLNVTYVPQN PTTGIFPGDG SGKQETRAGV VH. It is sometimes possible for the material contained within the vial of "CD33/Siglec-3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.