Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin 12 Active Protein | IL 12 active protein

Recombinant Human Interleukin 12

Gene Names
IL12A; P35; CLMF; NFSK; NKSF1; IL-12A
Purity
Greater than 95% as obsereved by SDS-PAGE.
Synonyms
Interleukin 12; Recombinant Human Interleukin 12; NKSF; CTL maturation factor (TCMF); Cytotoxic lymphocyte maturation factor (CLMF); TSF; Edodekin-alpha; IL-12; IL 12 active protein
Ordering
For Research Use Only!
Host
HEK
Purity/Purification
Greater than 95% as obsereved by SDS-PAGE.
Form/Format
The IL12 was lyophilized from 1mg/ml in 1xPBS.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
IL-12 is a heterodimer of IL-12A and IL-12B linked through a disulfide-bond between cysteines in red in sequences below. >IL-12 ARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS.>IL-12BIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Sequence Length
253
Solubility
It is recommended to reconstitute the lyophilized IL12 in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Biological Activity
The specific activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20ng/mL rIL-2. The EC50 is 0.5ng/ml.
Preparation and Storage
Lyophilized IL-12 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C.
Upon reconstitution IL12 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Related Product Information for IL 12 active protein
Description: Interleukin-12 Human Recombinant produced in HEK cells is a glycosylated heterodimer, having a total molecular weight of 57kDa.The IL12 is purified by proprietary chromatographic techniques.

Introduction: IL-12 is a heterodimeric cytokine that stimulates the production of interferon gamma from T-cells and natural killer cells, and also induces differentiation of Th1 helper cells. IL-12 is an initiator of cell-mediated immunity.
Product Categories/Family for IL 12 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
interleukin 12
NCBI Official Synonym Full Names
interleukin 12A
NCBI Official Symbol
IL12A
NCBI Official Synonym Symbols
P35; CLMF; NFSK; NKSF1; IL-12A
NCBI Protein Information
interleukin-12 subunit alpha; CLMF p35; IL-12, subunit p35; IL35 subunit; NF cell stimulatory factor chain 1; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12, p35; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); interleukin-12 alpha chain
UniProt Protein Name
Interleukin-12 subunit alpha
UniProt Gene Name
IL12A
UniProt Synonym Gene Names
NKSF1; IL-12A; CLMF p35; NKSF1
UniProt Entry Name
IL12A_HUMAN

NCBI Description

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

Uniprot Description

IL12A: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine- activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. Belongs to the IL-6 superfamily.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 3q25.33

Cellular Component: extracellular space; interleukin-12 complex; cytoplasm

Molecular Function: interleukin-27 binding; protein binding; growth factor activity; interleukin-12 beta subunit binding; protein heterodimerization activity; cytokine activity; interleukin-12 receptor binding

Biological Process: positive regulation of NK T cell activation; cell migration; positive regulation of cell adhesion; negative regulation of smooth muscle cell proliferation; positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target; positive regulation of T cell mediated cytotoxicity; response to virus; positive regulation of tyrosine phosphorylation of Stat4 protein; response to lipopolysaccharide; defense response to protozoan; positive regulation of natural killer cell mediated cytotoxicity; positive regulation of natural killer cell activation; response to UV-B; positive regulation of interferon-gamma production; defense response to Gram-positive bacterium; negative regulation of interleukin-17 production; positive regulation of mononuclear cell proliferation; positive regulation of T cell differentiation; positive regulation of lymphocyte proliferation; positive regulation of T cell proliferation; immune response; cell cycle arrest

Research Articles on IL 12

Similar Products

Product Notes

The IL 12 il12a (Catalog #AAA144673) is an Active Protein produced from HEK and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: IL-12 is a heterodime r of IL-12A and IL-12B linked through a disulfide- bond between cysteines in red in sequences below. >IL-12 ARNLPVATPD PGMFPCLHHS QNLLRAVSNM LQKARQTLEF YPCTSEEIDH EDITKDKTST VEACLPLELT KNESCLNSRE TSFITNGSCL ASRKTSFMMA LCLSSIYEDL KMYQVEFKTM NAKLLMDPKR QIFLDQNMLA VIDELMQALN FNSETVPQKS SLEEPDFYKT KIKLCILLHA FRIRAVTIDR VMSYLNAS.& gt;IL-12BI WELKKDVYVV ELDWYPDAPG EMVVLTCDTP EEDGITWTLD QSSEVLGSGK TLTIQVKEFG DAGQYTCHKG GEVLSHSLLL LHKKEDGIWS TDILKDQKEP KNKTFLRCEA KNYSGRFTCW WLTTISTDLT FSVKSSRGSS DPQGVTCGAA TLSAERVRGD NKEYEYSVEC QEDSACPAAE ESLPIEVMVD AVHKLKYENY TSSFFIRDII KPDPPKNLQL KPLKNSRQVE VSWEYPDTWS TPHSYFSLTF CVQVQGKSKR EKKDRVFTDK TSATVICRKN ASISVRAQDR YYSSSWSEWA SVPCS. It is sometimes possible for the material contained within the vial of "Interleukin 12, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.