Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (in vitro expressed and purified HBsAg adr protein)

HBsAg adr Recombinant Protein | HBsAg recombinant protein

HBsAg adr, Hepatitis B Surface Antigen adr subtype, CHO

Applications
Western Blot, ELISA
Purity
> 95% (by SDS-PAGE)
Purified by proprietary chromatographic technique
Synonyms
HBsAg adr; Hepatitis B Surface Antigen adr subtype; CHO; HBsAg adr recombinant protein; HBsAg adr Recombinant Protein; HBsAg recombinant protein
Ordering
For Research Use Only!
Host
CHO.
Purity/Purification
> 95% (by SDS-PAGE)
Purified by proprietary chromatographic technique
Concentration
50 mug/300 mul in 20 mM phosphate, 154 mM sodium chloride. (varies by lot)
Applicable Applications for HBsAg recombinant protein
Western Blot (WB), ELISA (EIA)
Application Notes
Immunochromatography, antibody ELISA, antigen, etc.
Preparation and Storage
Store at 4 degree C but should be kept at -20 degree C for long term storage. Non-hazardous.

Testing Data

(in vitro expressed and purified HBsAg adr protein)

Testing Data (in vitro expressed and purified HBsAg adr protein)
Related Product Information for HBsAg recombinant protein
Description: The CHO expressed recombinant Hepatitis B virus HBsAg adr full length monomeric protein contains 227 amino acids of the S-gene with a molecular weight of 24 kDa. Small amounts of dimmer and trimer forms also exist in the solution.
The CHO expressed recombinant HBsAg adr full length monomeric protein contains 226 amino acids of the S-gene with a molecular weight of 25 kDa. Small amounts of dimmer and trimer forms also exist in the solution.
Sequence: MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQS PTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLL PGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEW ASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFF CLWVYI(Genebank accession#, ACX36042).
Product Categories/Family for HBsAg recombinant protein

Similar Products

Product Notes

The HBsAg (Catalog #AAA434102) is a Recombinant Protein produced from CHO. and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HBsAg adr can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Immunochromatography, antibody ELISA, antigen, etc. Researchers should empirically determine the suitability of the HBsAg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HBsAg adr, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.