3-hydroxyacyl-CoA dehydratase 4 (PTPLAD2) Recombinant Protein | PTPLAD2 recombinant protein
Recombinant Human 3-hydroxyacyl-CoA dehydratase 4 (PTPLAD2)
Gene Names
HACD4; PTPLAD2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydratase 4 (PTPLAD2); Recombinant Human 3-hydroxyacyl-CoA dehydratase 4 (PTPLAD2); PTPLAD2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-232aa; full length protein
Sequence
MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV MRLCQSVSLLELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVF WNLLDMVRYTYSMLSVIGISYAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTY STKLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERRDILGIFPIKKKKM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PTPLAD2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,520 Da
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4 isoform 1
NCBI Official Synonym Full Names
3-hydroxyacyl-CoA dehydratase 4
NCBI Official Symbol
HACD4
NCBI Official Synonym Symbols
PTPLAD2
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
UniProt Gene Name
HACD4
UniProt Synonym Gene Names
HACD4
UniProt Entry Name
HACD4_HUMAN
Uniprot Description
PTPLAD2: Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis. Belongs to the very long-chain fatty acids dehydratase HACD family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; EC 4.2.1.134
Chromosomal Location of Human Ortholog: 9p21.3
Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral to membrane
Molecular Function: 3-hydroxyacyl-CoA dehydratase activity; enzyme binding
Biological Process: fatty acid elongation; very-long-chain fatty acid biosynthetic process
Research Articles on PTPLAD2
1. PTPLAD2 is a potential tumor suppressor and prognostic indicator that reduces STAT3 phosphorylation.
Similar Products
Product Notes
The PTPLAD2 hacd4 (Catalog #AAA7028267) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-232aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PTPLAD2 hacd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGPLALPAWL QPRYRKNAYL FIYYLIQFCG HSWIFTNMTV RFFSFGKDSM VDTFYAIGLV MRLCQSVSLL ELLHIYVGIE SNHLLPRFLQ LTERIIILFV VITSQEEVQE KYVVCVLFVF WNLLDMVRYT YSMLSVIGIS YAVLTWLSQT LWMPIYPLCV LAEAFAIYQS LPYFESFGTY STKLPFDLSI YFPYVLKIYL MMLFIGMYFT YSHLYSERRD ILGIFPIKKK KM. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydratase 4 (PTPLAD2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
