3-hydroxyacyl-CoA dehydratase (PTPLAD1) Recombinant Protein | PTPLAD1 recombinant protein
Recombinant Chicken 3-hydroxyacyl-CoA dehydratase (PTPLAD1)
Gene Names
HACD3; HACD; B-IND1; PTPLAD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-hydroxyacyl-CoA dehydratase (PTPLAD1); Recombinant Chicken 3-hydroxyacyl-CoA dehydratase (PTPLAD1); PTPLAD1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-362aa; full length protein
Sequence
MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIE FLEPVEPKPVCRVTQRQLNITVQKKESSWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL KEKEEEKINKMKIESRVPKDPFKHLKKGYLIMYNLVQFLGFSWIFVNMTVRLFILGKDSF YDTFHTIADMMYFCQTLALMEILNSLIGLVRSPLIPAVIQVFGRNFILFVVLGSLEEMQS KAVVFFLFYFWSIIELFRYPYYMLSCMGIEWKPLTWLRYTSWIPLYPLGGLAEAVCLIQS IPIFSETGKFSLGLPNPLNVTIQFSFLLQMYLIALFLGLFVNFRYLYKQRKQHLGPKKRK MK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Chicken
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PTPLAD1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,835 Da
NCBI Official Full Name
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
NCBI Official Synonym Full Names
3-hydroxyacyl-CoA dehydratase 3
NCBI Official Symbol
HACD3
NCBI Official Synonym Symbols
HACD; B-IND1; PTPLAD1
NCBI Protein Information
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
UniProt Protein Name
Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
UniProt Gene Name
HACD3
UniProt Synonym Gene Names
PTPLAD1Curated; HACDCurated
UniProt Entry Name
HACD3_CHICK
Uniprot Description
Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Involved in Rac1-signaling pathways leading to the modulation of gene expression.
Similar Products
Product Notes
The PTPLAD1 hacd3 (Catalog #AAA7028261) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-362aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PTPLAD1 hacd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADCSLRPHV HWAQRHRELY LRVELSDVKN PDVSIADNVL RFRAQGHGAK GDNIYEFQIE FLEPVEPKPV CRVTQRQLNI TVQKKESSWW ERLTKQEKRP LFLAPDFDRW LDESDAEMEL KEKEEEKINK MKIESRVPKD PFKHLKKGYL IMYNLVQFLG FSWIFVNMTV RLFILGKDSF YDTFHTIADM MYFCQTLALM EILNSLIGLV RSPLIPAVIQ VFGRNFILFV VLGSLEEMQS KAVVFFLFYF WSIIELFRYP YYMLSCMGIE WKPLTWLRYT SWIPLYPLGG LAEAVCLIQS IPIFSETGKF SLGLPNPLNV TIQFSFLLQM YLIALFLGLF VNFRYLYKQR KQHLGPKKRK MK. It is sometimes possible for the material contained within the vial of "3-hydroxyacyl-CoA dehydratase (PTPLAD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
