Granzyme A (Gzma) Recombinant Protein | Gzma recombinant protein

Recombinant Mouse Granzyme A (Gzma)

Cat. Num. AAA951351

• Gene Names: Gzma; Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Granzyme A (Gzma); Recombinant Mouse Granzyme A (Gzma); Granzyme A; EC=3.4.21.78; Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1; TSP-1; Gzma recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 29-260aa; Full Length of Mature Protein
• Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

• Species: Mus musculus (Mouse)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for Gzma recombinant protein

Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity).

Product Categories/Family for Gzma recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 6754102
• NCBI GeneID: 14938
• NCBI Accession #: NP_034500.1
• NCBI GenBank Nucleotide #: NM_010370.2
• UniProt Accession #: P11032; P15118
• Molecular Weight: 39.6 kDa
• NCBI Official Full Name: granzyme A
• NCBI Official Synonym Full Names: granzyme A
• NCBI Official Symbol: Gzma
• NCBI Official Synonym Symbols: Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114
• NCBI Protein Information: granzyme A; H factor; BLT esterase; fragmentin-1; Hanukah factor; serine esterase 1; t cell-specific serine protease 1; autocrine thymic lymphoma granzyme-like serine protease
• UniProt Protein Name: Granzyme A
• Protein Family: Granzyme
• UniProt Gene Name: Gzma
• UniProt Synonym Gene Names: Ctla-3; Ctla3; Mtsp-1; TSP-1
• UniProt Entry Name: GRAA_MOUSE

Uniprot Description

GZMA: This enzyme is necessary for target cell lysis in cell- mediated immune responses. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Involved in apoptosis. Homodimer; disulfide-linked. Interacts with APEX1. Dexamethasone (DEX) induces expression of isoform beta and represses expression of isoform alpha. The alteration in expression is mediated by binding of glucocorticoid receptor to independent promoters adjacent to the alternative first exons of isoform alpha and isoform beta. Belongs to the peptidase S1 family. Granzyme subfamily. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Secreted, signal peptide; Protease; Secreted; EC 3.4.21.78; Apoptosis

Cellular Component: extracellular region; nucleus

Molecular Function: peptidase activity; protein homodimerization activity; hydrolase activity; serine-type peptidase activity; serine-type endopeptidase activity; catalytic activity

Biological Process: proteolysis involved in cellular protein catabolic process; positive regulation of apoptosis; apoptosis; cytolysis; negative regulation of oxidoreductase activity; negative regulation of endodeoxyribonuclease activity; proteolysis; negative regulation of DNA binding