Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 (GUX5) Recombinant Protein | GUX5 recombinant protein
Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 (GUX5)
Gene Names
PGSIP5; F7G19.14; F7G19_14; PGSIP5; plant glycogenin-like starch initiation protein 5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 (GUX5); Recombinant Arabidopsis thaliana Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 (GUX5); GUX5 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-566aa; full length protein
Sequence
MGAKSKSSSTRFFMFYLILISLSFLGLLLNFKPLFLLNPMIASPSIVEIRYSLPEPVKRT PIWLRLIRNYLPDEKKIRVGLLNIAENERESYEASGTSILENVHVSLDPLPNNLTWTSLF PVWIDEDHTWHIPSCPEVPLPKMEGSEADVDVVVVKVPCDGFSEKRGLRDVFRLQVNLAA ANLVVESGRRNVDRTVYVVFIGSCGPMHEIFRCDERVKRVGDYWVYRPDLTRLKQKLLMP PGSCQIAPLGQGEAWIQDKNRNLTSEKTTLSSFTAQRVAYVTLLHSSEVYVCGAIALAQS IRQSGSTKDMILLHDDSITNISLIGLSLAGWKLRRVERIRSPFSKKRSYNEWNYSKLRVW QVTDYDKLVFIDADFIIVKNIDYLFSYPQLSAAGNNKVLFNSGVMVLEPSACLFEDLMLK SFKIGSYNGGDQGFLNEYFVWWHRLSKRLNTMKYFGDESRHDKARNLPENLEGIHYLGLK PWRCYRDYDCNWDLKTRRVYASESVHARWWKVYDKMPKKLKGYCGLNLKMEKNVEKWRKM AKLNGFPENHWKIRIKDPRKKNRLSQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GUX5 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,633 Da
NCBI Official Full Name
plant glycogenin-like starch initiation protein 5
NCBI Official Symbol
PGSIP5
NCBI Official Synonym Symbols
F7G19.14; F7G19_14; PGSIP5; plant glycogenin-like starch initiation protein 5
NCBI Protein Information
plant glycogenin-like starch initiation protein 5
UniProt Protein Name
Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5
Protein Family
UniProt Gene Name
GUX5
UniProt Synonym Gene Names
PGSIP5; UDP-GlcA:xylan glucuronyltransferase 5; AtGUX5
UniProt Entry Name
GUX5_ARATH
Uniprot Description
May be involved in the substitutions of the xylan backbone in stem glucuronoxylan.
Similar Products
Product Notes
The GUX5 gux5 (Catalog #AAA7016484) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-566aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GUX5 gux5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGAKSKSSST RFFMFYLILI SLSFLGLLLN FKPLFLLNPM IASPSIVEIR YSLPEPVKRT PIWLRLIRNY LPDEKKIRVG LLNIAENERE SYEASGTSIL ENVHVSLDPL PNNLTWTSLF PVWIDEDHTW HIPSCPEVPL PKMEGSEADV DVVVVKVPCD GFSEKRGLRD VFRLQVNLAA ANLVVESGRR NVDRTVYVVF IGSCGPMHEI FRCDERVKRV GDYWVYRPDL TRLKQKLLMP PGSCQIAPLG QGEAWIQDKN RNLTSEKTTL SSFTAQRVAY VTLLHSSEVY VCGAIALAQS IRQSGSTKDM ILLHDDSITN ISLIGLSLAG WKLRRVERIR SPFSKKRSYN EWNYSKLRVW QVTDYDKLVF IDADFIIVKN IDYLFSYPQL SAAGNNKVLF NSGVMVLEPS ACLFEDLMLK SFKIGSYNGG DQGFLNEYFV WWHRLSKRLN TMKYFGDESR HDKARNLPEN LEGIHYLGLK PWRCYRDYDC NWDLKTRRVY ASESVHARWW KVYDKMPKKL KGYCGLNLKM EKNVEKWRKM AKLNGFPENH WKIRIKDPRK KNRLSQ. It is sometimes possible for the material contained within the vial of "Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 5 (GUX5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
