Glutathione S-transferase P Recombinant Protein | Gstp1 recombinant protein

Recombinant Rat Glutathione S-transferase P

Cat. Num. AAA717854

• Gene Names: Gstp1; Gst3; Gstp; GST-P; Gstp2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glutathione S-transferase P; Recombinant Rat Glutathione S-transferase P; Chain 7GST 7-7GST class-pi; Gstp1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-210. Full Length of Mature Protein
• Sequence: PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Gstp1 recombinant protein

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.

References

Cloning and the nucleotide sequence of rat glutathione S-transferase P cDNA.Suguoka Y., Kano T., Okuda A., Sakai M., Kitagawa T., Muramatsu M.Nucleic Acids Res. 13:6049-6057(1985) The structure of the rat glutathione S-transferase P gene and related pseudogenes.Okuda A., Sakai M., Muramatsu M.J. Biol. Chem. 262:3858-3863(1987) Purification and characterization of P-52 (glutathione S-transferase-P or 7-7) from normal liver and putative preneoplastic liver nodules.Rushmore T.H., Harris L., Nagai M., Sharma R.N., Hayes M.A., Cameron R.G., Murray R.K., Farber E.Cancer Res. 48:2805-2812(1988) Lubec G., Afjehi-Sadat L., Chen W.-Q.Submitted (JAN-2009) to UniProtKB Identification of three classes of cytosolic glutathione transferase common to several mammalian species correlation between structural data and enzymatic properties.Mannervik B., Alin P., Guthenberg C., Jensson H., Tahir M.K., Warholm M., Joernvall H.Proc. Natl. Acad. Sci. U.S.A. 82:7202-7206(1985)

NCBI and Uniprot Product Information

• NCBI GI #: 25453420
• NCBI GeneID: 24426
• NCBI Accession #: NP_036709.1
• NCBI GenBank Nucleotide #: NM_012577.2
• UniProt Accession #: P04906
• Molecular Weight: 27.3 kDa
• NCBI Official Full Name: glutathione S-transferase P
• NCBI Official Synonym Full Names: glutathione S-transferase pi 1
• NCBI Official Symbol: Gstp1
• NCBI Official Synonym Symbols: Gst3; Gstp; GST-P; Gstp2
• NCBI Protein Information: glutathione S-transferase P
• UniProt Protein Name: Glutathione S-transferase P
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: Gstp1
• UniProt Entry Name: GSTP1_RAT

NCBI Description

may play a role in drug and xenobiotic metabolism [RGD, Feb 2006]

Uniprot Description

GSTP1: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Homodimer. Interacts with CDK5. Belongs to the GST superfamily. Pi family.

Protein type: EC 2.5.1.18; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase

Cellular Component: cytoplasm; cytosol; extracellular space; intracellular; mitochondrion; nucleus; plasma membrane; protein complex; vesicle

Molecular Function: drug binding; glutathione binding; glutathione transferase activity; JUN kinase binding; kinase regulator activity; protein kinase binding

Biological Process: cellular response to insulin stimulus; glutathione metabolic process; negative regulation of biosynthetic process; negative regulation of fibroblast proliferation; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of interleukin-1 beta production; negative regulation of JNK activity; negative regulation of MAP kinase activity; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of protein kinase activity; negative regulation of stress-activated MAPK cascade; negative regulation of tumor necrosis factor production; oligodendrocyte development; organ regeneration; positive regulation of superoxide release; regulation of stress-activated MAPK cascade; response to amino acid stimulus; response to estradiol stimulus; response to ethanol; response to L-ascorbic acid; response to nutrient levels; response to reactive oxygen species; response to toxin; xenobiotic metabolic process