Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gastrin-releasing peptide receptor (Grpr) Recombinant Protein | Grpr recombinant protein

Recombinant Rat Gastrin-releasing peptide receptor (Grpr)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gastrin-releasing peptide receptor (Grpr); Recombinant Rat Gastrin-releasing peptide receptor (Grpr); Recombinant Gastrin-releasing peptide receptor (Grpr); Gastrin-releasing peptide receptor; GRP-R; GRP-preferring bombesin receptor; Grpr recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-384
Sequence
MDPNNCSHLNLEVDPFLSCNNTFNQTLSPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMTSFKSTNPSATFSLINGNICHEGYV
Sequence Length
384
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,209 Da
NCBI Official Full Name
gastrin-releasing peptide receptor
NCBI Official Synonym Full Names
gastrin releasing peptide receptor
NCBI Official Symbol
Grpr
NCBI Protein Information
gastrin-releasing peptide receptor; GRP-R; GRP-preferring bombesin receptor
UniProt Protein Name
Gastrin-releasing peptide receptor
UniProt Gene Name
Grpr
UniProt Synonym Gene Names
GRP-R
UniProt Entry Name
GRPR_RAT

NCBI Description

G-protein coupled receptor for the mammalian bombesis peptide, may be involved in the development and/or maintenace of specific hindbrain segments [RGD, Feb 2006]

Uniprot Description

GRPR: Receptor for gastrin releasing peptide (GRP). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; GPCR, family 1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide binding; bombesin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; learning and/or memory; bombesin receptor signaling pathway; social behavior; regulation of cell proliferation

Research Articles on Grpr

Similar Products

Product Notes

The Grpr grpr (Catalog #AAA962630) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-384. The amino acid sequence is listed below: MDPNNCSHLN LEVDPFLSCN NTFNQTLSPP KMDNWFHPGI IYVIPAVYGL IIVIGLIGNI TLIKIFCTVK SMRNVPNLFI SSLALGDLLL LVTCAPVDAS KYLADRWLFG RIGCKLIPFI QLTSVGVSVF TLTALSADRY KAIVRPMDIQ ASHALMKICL KAALIWIVSM LLAIPEAVFS DLHPFHVKDT NQTFISCAPY PHSNELHPKI HSMASFLVFY IIPLSIISVY YYFIARNLIQ SAYNLPVEGN IHVKKQIESR KRLAKTVLVF VGLFAFCWLP NHVIYLYRSY HYSEVDTSML HFITSICARL LAFTNSCVNP FALYLLSKSF RKQFNTQLLC CQPSLLNRSH STGRSTTCMT SFKSTNPSAT FSLINGNICH EGYV. It is sometimes possible for the material contained within the vial of "Gastrin-releasing peptide receptor (Grpr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.