Serine/threonine-protein kinase grp (grp) Recombinant Protein | grp recombinant protein
Recombinant Drosophila melanogaster Serine/threonine-protein kinase grp (grp), partial
Gene Names
grp; 1C; CG17161; chk1; Chk1; CHK1; CHK1/Grapes; dChk1; Dchk1; DmChk1; DmelCG17161; Grp; grp(chk); Grp/DChk1; grps; l(2)k15102; lemp; Pk36A; Pk?1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase grp (grp); Recombinant Drosophila melanogaster Serine/threonine-protein kinase grp (grp); partial; grp recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-282. Partial
Sequence
MAATLTEAGTGPAATREFVEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVDLKKHPDAANSVRKEVCIQKMLQDKHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVLQKAYHAQPADLWSCGVILVTMLAGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATSPGTRLTLEKTLDHKWCNMQ
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,833 Da
NCBI Official Full Name
grapes, isoform A
NCBI Official Synonym Full Names
grapes
NCBI Official Symbol
grp
NCBI Official Synonym Symbols
1C; CG17161; chk1; Chk1; CHK1; CHK1/Grapes; dChk1; Dchk1; DmChk1; DmelCG17161; Grp; grp(chk); Grp/DChk1; grps; l(2)k15102; lemp; Pk36A; Pk?1
NCBI Protein Information
CG17161 gene product from transcript CG17161-RC
UniProt Protein Name
Serine/threonine-protein kinase grp
Protein Family
UniProt Gene Name
grp
Uniprot Description
Serine/threonine-protein kinase which is required for checkpoint-mediated cell cycle arrest and activation of DNA repair in response to the presence of DNA damage or unreplicated DNA. May also negatively regulate cell cycle progression during unperturbed cell cycles. May phosphorylate the CDC25 phosphatase stg, which promotes its degradation. This results in increased inhibitory tyrosine phosphorylation of Cdk1-cyclin complexes and consequent inhibition of cell cycle progression.
Research Articles on grp
Similar Products
Product Notes
The grp grp (Catalog #AAA1065825) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-282. Partial. The amino acid sequence is listed below: MAATLTEAGT GPAATREFVE GWTLAQTLGE GAYGEVKLLI NRQTGEAVAM KMVDLKKHPD AANSVRKEVC IQKMLQDKHI LRFFGKRSQG SVEYIFLEYA AGGELFDRIE PDVGMPQHEA QRYFTQLLSG LNYLHQRGIA HRDLKPENLL LDEHDNVKIS DFGMATMFRC KGKERLLDKR CGTLPYVAPE VLQKAYHAQP ADLWSCGVIL VTMLAGELPW DQPSTNCTEF TNWRDNDHWQ LQTPWSKLDT LAISLLRKLL ATSPGTRLTL EKTLDHKWCN MQ . It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase grp (grp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
