Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glutamate [NMDA] receptor subunit epsilon-1 (Grin2a) Recombinant Protein | Grin2a recombinant protein

Recombinant Mouse Glutamate [NMDA] receptor subunit epsilon-1 (Grin2a) , partial

Gene Names
Grin2a; NR2A; GluN2A; NMDAR2A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate [NMDA] receptor subunit epsilon-1 (Grin2a); Recombinant Mouse Glutamate [NMDA] receptor subunit epsilon-1 (Grin2a); partial; Grin2a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
646-816. Partial.
Sequence
TANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQRGVEDALVSLKTGKLDAFIYDAAVLN YKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDN
Sequence Length
816
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165,421 Da
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 2A
NCBI Official Synonym Full Names
glutamate receptor, ionotropic, NMDA2A (epsilon 1)
NCBI Official Symbol
Grin2a
NCBI Official Synonym Symbols
NR2A; GluN2A; NMDAR2A
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2A
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 2A
UniProt Gene Name
Grin2a
UniProt Synonym Gene Names
NMDAR2A; NR2A

Uniprot Description

Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium (PubMed:1374164). Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg2+. Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have higher sensitivity to glutamate and faster kinetics than channels formed by GRIN1 and GRIN2B (). Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning (PubMed:7816096, PubMed:8987814).

Research Articles on Grin2a

Similar Products

Product Notes

The Grin2a grin2a (Catalog #AAA954218) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 646-816. Partial. The amino acid sequence is listed below: TANLAAFMIQ EEFVDQVTGL SDKKFQRPHD YSPPFRFGTV PNGSTERNIR NNYPYMHQYM TKFNQRGVED ALVSLKTGKL DAFIYDAAVL N YKAGRDE GCKLVTIGSG YIFATTGYGI ALQKGSPWKR QIDLALLQFV GDGEMEELET LWLTGICHNE KNEVMSSQLD IDN . It is sometimes possible for the material contained within the vial of "Glutamate [NMDA] receptor subunit epsilon-1 (Grin2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.