Glutamate [NMDA] receptor subunit epsilon-1 (GRIN2A) Recombinant Protein | GRIN2A recombinant protein
Recombinant Pan troglodytes Glutamate [NMDA] receptor subunit epsilon-1 (GRIN2A), partial
Gene Names
GRIN2A; NR2A; GluN2A; NMDAR2A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate [NMDA] receptor subunit epsilon-1 (GRIN2A); Recombinant Pan troglodytes Glutamate [NMDA] receptor subunit epsilon-1 (GRIN2A); partial; GRIN2A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
646-816. Partial.
Sequence
TANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDN
Sequence Length
816
Species
Pan troglodytes (Chimpanzee)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165,280 Da
NCBI Official Full Name
glutamate receptor ionotropic, NMDA 2A
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit 2A
NCBI Official Symbol
GRIN2A
NCBI Official Synonym Symbols
NR2A; GluN2A; NMDAR2A
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2A
UniProt Protein Name
Glutamate receptor ionotropic, NMDA 2A
Protein Family
UniProt Gene Name
GRIN2A
UniProt Synonym Gene Names
GluN2A; NMDAR2A; NR2A
Uniprot Description
Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg2+. Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have higher sensitivity to glutamate and faster kinetics than channels formed by GRIN1 and GRIN2B. Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning ().
Similar Products
Product Notes
The GRIN2A grin2a (Catalog #AAA7083037) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 646-816. Partial. The amino acid sequence is listed below: TANLAAFMIQ EEFVDQVTGL SDKKFQRPHD YSPPFRFGTV PNGSTERNIR NNYPYMHQYM TKFNQKGVED ALVSLKTGKL DAFIYDAAVL NYKAGRDEGC KLVTIGSGYI FATTGYGIAL QKGSPWKRQI DLALLQFVGD GEMEELETLW LTGICHNEKN EVMSSQLDID N . It is sometimes possible for the material contained within the vial of "Glutamate [NMDA] receptor subunit epsilon-1 (GRIN2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
