Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) ()

Glypican 6 Recombinant Protein | GPC6 recombinant protein

Glypican 6 protein (His tag)

Gene Names
GPC6; OMIMD1
Applications
ELISA, SDS-Page, Western Blot
Purity
> 90% pure
Synonyms
Glypican 6; Glypican 6 protein (His tag); Glypican-6 protein; Glypican6 protein; GPC6 recombinant protein
Ordering
For Research Use Only!
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied in liquid form in a Tris based buffer with 50% glycerol
Sequence
DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEF ENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLF TELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDV PRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTV RPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAI MNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDR LVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQ INNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMD DVCPTEFEFVTTEAPAVDPDRREVDS
Sequence Length
555
Applicable Applications for GPC6 recombinant protein
ELISA (EIA), SDS-PAGE, Western Blot (WB)
Protein Type
Recombinant
Biological Significance
Glypican 6 is a cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases.
Expression System
E Coli
Tag/Conjugate
His tag
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles

Western Blot (WB)

()

Western Blot (WB) ()
Related Product Information for GPC6 recombinant protein
Purified recombinant Glypican 6 protein (His tag)
Product Categories/Family for GPC6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60 kDa
NCBI Official Full Name
glypican-6
NCBI Official Synonym Full Names
glypican 6
NCBI Official Symbol
GPC6
NCBI Official Synonym Symbols
OMIMD1
NCBI Protein Information
glypican-6
UniProt Protein Name
Glypican-6
Protein Family
UniProt Gene Name
GPC6
UniProt Entry Name
GPC6_HUMAN

NCBI Description

The glypicans comprise a family of glycosylphosphatidylinositol-anchored heparan sulfate proteoglycans, and they have been implicated in the control of cell growth and cell division. The glypican encoded by this gene is a putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases. [provided by RefSeq, Jan 2009]

Uniprot Description

GPC6: Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases. Enhances migration and invasion of cancer cells through WNT5A signaling. Defects in GPC6 are a cause of omodysplasia type 1 (OMOD1). OMOD1 is a rare autosomal recessive skeletal dysplasia characterized by severe congenital micromelia with shortening and distal tapering of the humeri and femora to give a club-like appearance. Typical facial features include a prominent forehead, frontal bossing, short nose with a depressed broad bridge, short columella, anteverted nostrils, long philtrum, and small chin. Point mutations leading to protein truncation, as well as larger genomic rearrangements resulting in exon deletions, have been found in family segregating omodysplasia type 1. All mutations identified in individuals affected by omodysplasia could lead to the absence of a functional protein, the mutant RNAs being suspected to be nonsense-mediated mRNA decay (NMD) targets. Even if the mRNA escapes NMD and is translated, all mutations are expected to disrupt the three-dimensional protein structure and often to abolish multiple highly conserved cysteine residues. Belongs to the glypican family.

Protein type: Cell surface; Motility/polarity/chemotaxis; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 13q32

Cellular Component: proteinaceous extracellular matrix; lysosomal lumen; extracellular space; integral to plasma membrane; Golgi lumen; plasma membrane; nucleus

Molecular Function: heparan sulfate proteoglycan binding

Biological Process: chondroitin sulfate metabolic process; phototransduction, visible light; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; cell migration; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis; retinoid metabolic process

Disease: Omodysplasia 1

Research Articles on GPC6

Similar Products

Product Notes

The GPC6 gpc6 (Catalog #AAA5304221) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Glypican 6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), SDS-PAGE, Western Blot (WB). Researchers should empirically determine the suitability of the GPC6 gpc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVKARSCGEV RQAYGAKGFS LADIPYQEIA GEHLRICPQE YTCCTTEMED KLSQQSKLEF ENLVEETSHF VRTTFVSRHK KFDEFFRELL ENAEKSLNDM FVRTYGMLYM QNSEVFQDLF TELKRYYTGG NVNLEEMLND FWARLLERMF QLINPQYHFS EDYLECVSKY TDQLKPFGDV PRKLKIQVTR AFIAARTFVQ GLTVGREVAN RVSKVSPTPG CIRALMKMLY CPYCRGLPTV RPCNNYCLNV MKGCLANQAD LDTEWNLFID AMLLVAERLE GPFNIESVMD PIDVKISEAI MNMQENSMQV SAKVFQGCGQ PKPAPALRSA RSAPENFNTR FRPYNPEERP TTAAGTSLDR LVTDIKEKLK LSKKVWSALP YTICKDESVT AGTSNEEECW NGHSKARYLP EIMNDGLTNQ INNPEVDVDI TRPDTFIRQQ IMALRVMTNK LKNAYNGNDV NFQDTSDESS GSGSGSGCMD DVCPTEFEFV TTEAPAVDPD RREVDS. It is sometimes possible for the material contained within the vial of "Glypican 6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.