Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gonadotropin-releasing hormone receptor (GNRHR) Recombinant Protein | GNRHR recombinant protein

Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gonadotropin-releasing hormone receptor (GNRHR); Recombinant Bovine Gonadotropin-releasing hormone receptor (GNRHR); Recombinant Gonadotropin-releasing hormone receptor (GNRHR); Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R; GNRHR recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-328
Sequence
MANSDSPEQNENHCSAINSSIPLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKLQNWTQRKEKRKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITKPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGMIHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMVICNAKIIFTLTRVLHQDPHKLQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRVSDPVNHFFFLFAFLNPCFDPLIYGYFSL
Sequence Length
328
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,741 Da
NCBI Official Full Name
gonadotropin-releasing hormone receptor
NCBI Official Synonym Full Names
gonadotropin-releasing hormone receptor<
NCBI Official Symbol
GNRHR
NCBI Protein Information
gonadotropin-releasing hormone receptor; gnRH-R; gnRH receptor; luteinizing-releasing hormone receptor
UniProt Protein Name
Gonadotropin-releasing hormone receptor
UniProt Gene Name
GNRHR
UniProt Synonym Gene Names
GnRH receptor; GnRH-R
UniProt Entry Name
GNRHR_BOVIN

Uniprot Description

Function: Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Research Articles on GNRHR

Similar Products

Product Notes

The GNRHR gnrhr (Catalog #AAA953135) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-328. The amino acid sequence is listed below: MANSDSPEQN ENHCSAINSS IPLTPGSLPT LTLSGKIRVT VTFFLFLLST IFNTSFLLKL QNWTQRKEKR KKLSRMKLLL KHLTLANLLE TLIVMPLDGM WNITVQWYAG ELLCKVLSYL KLFSMYAPAF MMVVISLDRS LAITKPLAVK SNSKLGQFMI GLAWLLSSIF AGPQLYIFGM IHLADDSGQT EGFSQCVTHC SFPQWWHQAF YNFFTFSCLF IIPLLIMVIC NAKIIFTLTR VLHQDPHKLQ LNQSKNNIPR ARLRTLKMTV AFATSFTVCW TPYYVLGIWY WFDPDMVNRV SDPVNHFFFL FAFLNPCFDP LIYGYFSL. It is sometimes possible for the material contained within the vial of "Gonadotropin-releasing hormone receptor (GNRHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.