Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-3 (GNB3) Recombinant Protein | GNB3 recombinant protein

Recombinant Dog Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-3 (GNB3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-3 (GNB3); Recombinant Dog Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-3 (GNB3); GNB3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-340, Full length protein
Sequence
MGEMEQLRQEAEQLKKQIADARKACADTTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSDESIICGITSVAFSLSGRLLFAGYDDFNCNIWDSMKGERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKVWN
Sequence Length
340
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GNB3 recombinant protein
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. A single-nucleotide polymorphism (C825T) in this gene is associated with essential hypertension and obesity. This polymorphism is also associated with the occurrence of the splice variant GNB3-s, which appears to have increased activity. GNB3-s is an example of alternative splicing caused by a nucleotide change outside of the splice donor and acceptor sites. Additional splice variants may exist for this gene, but they have not been fully described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,144 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
NCBI Official Synonym Full Names
G protein subunit beta 3
NCBI Official Symbol
GNB3
NCBI Protein Information
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
UniProt Protein Name
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
UniProt Gene Name
GNB3

Uniprot Description

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

Similar Products

Product Notes

The GNB3 gnb3 (Catalog #AAA966497) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-340, Full length protein. The amino acid sequence is listed below: MGEMEQLRQE AEQLKKQIAD ARKACADTTL AELVSGLEVV GRVQMRTRRT LRGHLAKIYA MHWATDSKLL VSASQDGKLI VWDTYTTNKV HAIPLRSSWV MTCAYAPSGN FVACGGLDNM CSIYSLKSRE GNVKVSRELS AHTGYLSCCR FLDDNNIVTS SGDTTCALWD IETGQQKTVF VGHTGDCMSL AVSPDFKLFI SGACDASAKL WDVREGTCRQ TFTGHESDIN AICFFPNGEA ICTGSDDASC RLFDLRADQE LTAYSDESII CGITSVAFSL SGRLLFAGYD DFNCNIWDSM KGERVGILSG HDNRVSCLGV TADGMAVATG SWDSFLKVWN. It is sometimes possible for the material contained within the vial of "Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-3 (GNB3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.