Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Guanine nucleotide-binding protein subunit beta-like protein 1 (Gnb1l) Recombinant Protein | Gnb1l recombinant protein

Recombinant Mouse Guanine nucleotide-binding protein subunit beta-like protein 1 (Gnb1l)

Gene Names
Gnb1l; Wdr14; Wdvcf; ESTM55; Gm16314; Me49f07
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanine nucleotide-binding protein subunit beta-like protein 1 (Gnb1l); Recombinant Mouse Guanine nucleotide-binding protein subunit beta-like protein 1 (Gnb1l); Gnb1l recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326, full length protein
Sequence
MAALFPPPPGPRFVLRGTQSAVNTLHFCPPSQAAGNPLLFSGSQNGLVHIWSLQTRRIVTTLNGHGGQGVIWLKTLPQGHQLLSQGRDLRLCLWDLEEGRNTIMDSVQLDSVGFCRGSILVRGQQCWMLAVPGKGSDEVQILEMPSKTSVCTLKPEADARPGMPMCLGLWQTNSSLRPLLLAGYEDGSVTLWDISERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQSLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFHSAPVYCVAFAADGLLAAGSKDQRISIWSLYPCP
Sequence Length
326
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gnb1l recombinant protein
This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,712 Da
NCBI Official Full Name
guanine nucleotide-binding protein subunit beta-like protein 1 isoform 1
NCBI Official Synonym Full Names
guanine nucleotide binding protein (G protein), beta polypeptide 1-like
NCBI Official Symbol
Gnb1l
NCBI Official Synonym Symbols
Wdr14; Wdvcf; ESTM55; Gm16314; Me49f07
NCBI Protein Information
guanine nucleotide-binding protein subunit beta-like protein 1
UniProt Protein Name
Guanine nucleotide-binding protein subunit beta-like protein 1
UniProt Gene Name
Gnb1l
UniProt Synonym Gene Names
Estm55; Wdr14; G protein subunit beta-like protein 1; WDVCF

Similar Products

Product Notes

The Gnb1l gnb1l (Catalog #AAA1405018) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326, full length protein. The amino acid sequence is listed below: MAALFPPPPG PRFVLRGTQS AVNTLHFCPP SQAAGNPLLF SGSQNGLVHI WSLQTRRIVT TLNGHGGQGV IWLKTLPQGH QLLSQGRDLR LCLWDLEEGR NTIMDSVQLD SVGFCRGSIL VRGQQCWMLA VPGKGSDEVQ ILEMPSKTSV CTLKPEADAR PGMPMCLGLW QTNSSLRPLL LAGYEDGSVT LWDISERKVC SQITCHEEPV MGLDFDSQKA KGISGSAGKV LAVWSLDDQQ SLQVKKTHEL TNPGIAEVTI RPDHKILATA GWDHRIRVFH WRTMKPLAVL AFHSAPVYCV AFAADGLLAA GSKDQRISIW SLYPCP. It is sometimes possible for the material contained within the vial of "Guanine nucleotide-binding protein subunit beta-like protein 1 (Gnb1l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.