Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Guanine nucleotide-binding protein G (t) subunit alpha-1 (GNAT1) Recombinant Protein | GNAT1 recombinant protein

Recombinant Bovine Guanine nucleotide-binding protein G (t) subunit alpha-1 (GNAT1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanine nucleotide-binding protein G (t) subunit alpha-1 (GNAT1); Recombinant Bovine Guanine nucleotide-binding protein G (t) subunit alpha-1 (GNAT1); GNAT1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-350, Full length protein
Sequence
GAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Sequence Length
349
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GNAT1 recombinant protein
Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,966 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(t) subunit alpha-1
NCBI Official Synonym Full Names
G protein subunit alpha transducin 1
NCBI Official Symbol
GNAT1
NCBI Protein Information
guanine nucleotide-binding protein G(t) subunit alpha-1
UniProt Protein Name
Guanine nucleotide-binding protein G(t) subunit alpha-1
UniProt Gene Name
GNAT1

Uniprot Description

Functions as signal transducer for the rod photoreceptor RHO (PubMed:21285355, PubMed:23303210, PubMed:28655769, PubMed:8259210). Required for normal RHO-mediated light perception by the retina (). Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs), such as the photoreceptor RHO. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state (PubMed:21285355, PubMed:28655769, PubMed:8259210, PubMed:8208289, PubMed:7969474). Activated RHO promotes GDP release and GTP binding (PubMed:21285355, PubMed:28655769). Signaling is mediated via downstream effector proteins, such as cGMP-phosphodiesterase (PubMed:21285355).

Research Articles on GNAT1

Similar Products

Product Notes

The GNAT1 gnat1 (Catalog #AAA963730) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-350, Full length protein. The amino acid sequence is listed below: GAGASAEEKH SRELEKKLKE DAEKDARTVK LLLLGAGESG KSTIVKQMKI IHQDGYSLEE CLEFIAIIYG NTLQSILAIV RAMTTLNIQY GDSARQDDAR KLMHMADTIE EGTMPKEMSD IIQRLWKDSG IQACFDRASE YQLNDSAGYY LSDLERLVTP GYVPTEQDVL RSRVKTTGII ETQFSFKDLN FRMFDVGGQR SERKKWIHCF EGVTCIIFIA ALSAYDMVLV EDDEVNRMHE SLHLFNSICN HRYFATTSIV LFLNKKDVFS EKIKKAHLSI CFPDYNGPNT YEDAGNYIKV QFLELNMRRD VKEIYSHMTC ATDTQNVKFV FDAVTDIIIK ENLKDCGLF. It is sometimes possible for the material contained within the vial of "Guanine nucleotide-binding protein G (t) subunit alpha-1 (GNAT1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual