Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Glycoprotein N (U46) Recombinant Protein | U46 recombinant protein

Recombinant Human herpesvirus 7 Glycoprotein N (U46)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein N (U46); Recombinant Human herpesvirus 7 Glycoprotein N (U46); U46 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-86
Sequence
NEVDGEELFYKPTCHSDTYEIILKKFSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVKGY
Sequence Length
86
Species
Human herpesvirus 7 (strain JI) (HHV-7) (Human T lymphotropic virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,196 Da
NCBI Official Full Name
envelope glycoprotein N
NCBI Official Symbol
U46
NCBI Protein Information
type 1 membrane protein; contains a signal peptide; complexed with envelope glycoprotein M; envelope glycoprotein N
UniProt Protein Name
Glycoprotein N
UniProt Gene Name
gN
UniProt Synonym Gene Names
gN
UniProt Entry Name
GN_HHV7J

Uniprot Description

Function: Envelope glycoprotein necessary for proper maturation of gM. May be involved in virus assembly

By similarity.

Subunit structure: Interacts with gM

By similarity. The gM-gN heterodimer forms the gCII complex

By similarity.

Subcellular location: Virion membrane; Single-pass type I membrane protein

By similarity. Host membrane; Single-pass type I membrane protein

By similarity. Host Golgi apparatus membrane; Single-pass membrane protein

By similarity.

Sequence similarities: Belongs to the betaherpesvirinae/gammaherpesvirinae glycoprotein N family.

Similar Products

Product Notes

The U46 gn (Catalog #AAA1023687) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-86. The amino acid sequence is listed below: NEVDGEELFY KPTCHSDTYE IILKKFSSIW ILVNTFILLC SFSLFLKYWC FKTLAKETVK GY. It is sometimes possible for the material contained within the vial of "Glycoprotein N (U46), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual