SDS-PAGE
Glutamine synthetase (GLUL) Recombinant Protein | GLUL recombinant protein
Recombinant Cricetulus griseus Glutamine synthetase (GLUL)
Gene Names
Glul; GS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamine synthetase (GLUL); Recombinant Cricetulus griseus Glutamine synthetase (GLUL); Glutamine synthetase; GS; EC=6.3.1.2; Glutamate decarboxylase; EC=4.1.1.15; Glutamate--ammonia ligase; GLUL recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-373aa; Full Length
Sequence
ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRHRYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGVADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAVTEAIVRTCLLNETGDQPFQYKN
Sequence Length
372
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for GLUL recombinant protein
Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity).
Product Categories/Family for GLUL recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58.2 kDa
NCBI Official Full Name
glutamine synthetase
NCBI Official Symbol
Glul
NCBI Official Synonym Symbols
GS
NCBI Protein Information
glutamine synthetase; Glutamate decarboxylase; Glutamate--ammonia ligase
UniProt Protein Name
Glutamine synthetase
UniProt Gene Name
GLUL
UniProt Synonym Gene Names
GS
UniProt Entry Name
GLNA_CRIGR
Uniprot Description
Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner ().
Similar Products
Product Notes
The GLUL glul (Catalog #AAA1124554) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-373aa; Full Length. The amino acid sequence is listed below: ATSASSHLNK GIKQMYMSLP QGEKVQAMYI WVDGTGEGLR CKTRTLDCEP KCVEELPEWN FDGSSTFQSE SSNSDMYLSP VAMFRDPFRK EPNKLVFCEV FKYNQKPAET NLRHTCKRIM DMVSNQHPWF GMEQEYTLLG TDGHPFGWPS DGFPGPQGLY YCGVGADKAY RRDIMEAHYR ACLYAGVKIT GTYAEVKHAQ WEFQIGPCEG IRMGDHLWVA RFILHRVCKD FGVIATFDSK PIPGNWNGAG CHTNFSTKTM REENGLKHIK EAIEKLSKRH RYHIRAYDPK GGLDNARRLT GFHKTSNIND FSAGVADRSA SIRIPRTVGQ EKKGYFEARC PSANCDPFAV TEAIVRTCLL NETGDQPFQY KN. It is sometimes possible for the material contained within the vial of "Glutamine synthetase (GLUL), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
