Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glutamate transport system permease protein gluD (gluD) Recombinant Protein | NCgl1878 recombinant protein

Recombinant Corynebacterium glutamicum Glutamate transport system permease protein gluD (gluD)

Gene Names
NCgl1878; Cgl1953
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate transport system permease protein gluD (gluD); Recombinant Corynebacterium glutamicum Glutamate transport system permease protein gluD (gluD); Recombinant Glutamate transport system permease protein gluD (gluD); Glutamate transport system permease protein gluD; NCgl1878 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-273
Sequence
MLSGNGQLDANKWTPFINSQTWTTYILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFAYQMFAQYNIVPSSQLAFAAVVFGLTMYNGSVIAEILRSGIASLPKGQKEAAIALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNRNYLAALFVVALIMIVLNFSLTALASRIERQLRAGRARKNIVAKVPEQPDQGLETKDNVNVDWQDPDYKDLKTPGVQ
Sequence Length
273
Species
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,866 Da
NCBI Official Full Name
glutamate ABC transporter permease
NCBI Official Symbol
NCgl1878
NCBI Official Synonym Symbols
Cgl1953
NCBI Protein Information
glutamate ABC transporter permease
UniProt Protein Name
Glutamate transport system permease protein GluD
UniProt Gene Name
gluD
UniProt Entry Name
GLUD_CORGL

Uniprot Description

Function: Part of the binding-protein-dependent transport system for glutamate; probably responsible for the translocation of the substrate across the membrane.

Subcellular location: Cell membrane; Multi-pass membrane protein

Potential.

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. HisMQ subfamily.Contains 1 ABC transmembrane type-1 domain.

Sequence caution: The sequence CAF20294.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The NCgl1878 glud (Catalog #AAA1145046) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-273. The amino acid sequence is listed below: MLSGNGQLDA NKWTPFINSQ TWTTYILPGL WGTLKSAVFS VILALVMGTA LGLGRISEIR ILRWFCAVII ETFRAIPVLI LMIFAYQMFA QYNIVPSSQL AFAAVVFGLT MYNGSVIAEI LRSGIASLPK GQKEAAIALG MSSRQTTWSI LLPQAVAAML PALISQMVIA LKDSALGYQI GYIEVVRSGI QSASVNRNYL AALFVVALIM IVLNFSLTAL ASRIERQLRA GRARKNIVAK VPEQPDQGLE TKDNVNVDWQ DPDYKDLKTP GVQ. It is sometimes possible for the material contained within the vial of "Glutamate transport system permease protein gluD (gluD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.