Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glutaminase kidney isoform Recombinant Protein | GLS recombinant protein

Recombinant Human Glutaminase kidney isoform, mitochondrial

Gene Names
GLS; GAC; GAM; KGA; GLS1; AAD20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutaminase kidney isoform; Recombinant Human Glutaminase kidney isoform; mitochondrial; K-glutaminase; L-glutamine amidohydrolase; GLS recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
616-669. Partial
Sequence
KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for GLS recombinant protein
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.
Product Categories/Family for GLS recombinant protein
References
"Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing." Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F. Physiol. Genomics 1:51-62(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.3 kDa
NCBI Official Full Name
glutaminase kidney isoform, mitochondrial isoform 2
NCBI Official Synonym Full Names
glutaminase
NCBI Official Symbol
GLS
NCBI Official Synonym Symbols
GAC; GAM; KGA; GLS1; AAD20
NCBI Protein Information
glutaminase kidney isoform, mitochondrial
UniProt Protein Name
Glutaminase kidney isoform, mitochondrial
Protein Family
UniProt Gene Name
GLS
UniProt Synonym Gene Names
GLS1; KIAA0838; GLS
UniProt Entry Name
GLSK_HUMAN

NCBI Description

This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

glutaminase: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. Belongs to the glutaminase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Amino Acid Metabolism - arginine and proline; EC 3.5.1.2; Other Amino Acids Metabolism - D-Glutamine and D-glutamate; Mitochondrial; Energy Metabolism - nitrogen; Amino Acid Metabolism - alanine, aspartate and glutamate

Chromosomal Location of Human Ortholog: 2q32-q34

Cellular Component: cytosol; mitochondrial matrix; mitochondrion

Molecular Function: glutaminase activity; protein binding

Biological Process: amino acid biosynthetic process; gene expression; glutamate biosynthetic process; glutamate secretion; glutamine catabolic process; neurological control of breathing; neurotransmitter secretion; protein homotetramerization; suckling behavior; synaptic transmission; transcription initiation from RNA polymerase II promoter

Research Articles on GLS

Similar Products

Product Notes

The GLS gls (Catalog #AAA969527) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 616-669. Partial. The amino acid sequence is listed below: KDRWNNTPMD EALHFGHHDV FKILQEYQVQ YTPQGDSDNG KENQTVHKNL DGLL. It is sometimes possible for the material contained within the vial of "Glutaminase kidney isoform, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.