Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glucagon-like peptide 2 receptor (GLP2R) Recombinant Protein | GLP2R recombinant protein

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glucagon-like peptide 2 receptor (GLP2R); Recombinant Human Glucagon-like peptide 2 receptor (GLP2R); Recombinant Glucagon-like peptide 2 receptor (GLP2R); Glucagon-like peptide 2 receptor; GLP-2 receptor; GLP-2-R; GLP-2R; GLP2R recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-173. N-terminal fragment, a complete extracellular domain
Sequence
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA
Sequence Length
173
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,001 Da
NCBI Official Full Name
glucagon-like peptide 2 receptor
NCBI Official Synonym Full Names
glucagon-like peptide 2 receptor
NCBI Official Symbol
GLP2R
NCBI Protein Information
glucagon-like peptide 2 receptor; GLP-2R; GLP-2-R; GLP-2 receptor
UniProt Protein Name
Glucagon-like peptide 2 receptor
UniProt Gene Name
GLP2R
UniProt Synonym Gene Names
GLP-2 receptor; GLP-2-R; GLP-2R
UniProt Entry Name
GLP2R_HUMAN

NCBI Description

The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition. GLP2R, a G protein-coupled receptor superfamily member is expressed in the gut and closely related to the glucagon receptor (GCGR) and the receptor for GLP1 (GLP1R). [provided by RefSeq, Jul 2008]

Uniprot Description

GLP2R: This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 17p13.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; glucagon receptor activity

Biological Process: G-protein signaling, coupled to cAMP nucleotide second messenger; positive regulation of cell proliferation

Research Articles on GLP2R

Similar Products

Product Notes

The GLP2R glp2r (Catalog #AAA1201698) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-173. N-terminal fragment, a complete extracellular domain. The amino acid sequence is listed below: MKLGSSRAGP GRGSAGLLPG VHELPMGIPA PWGTSPLSFH RKCSLWAPGR PFLTLVLLVS IKQVTGSLLE ETTRKWAQYK QACLRDLLKE PSGIFCNGTF DQYVCWPHSS PGNVSVPCPS YLPWWSEESS GRAYRHCLAQ GTWQTIENAT DIWQDDSECS ENHSFKQNVD RYA . It is sometimes possible for the material contained within the vial of "Glucagon-like peptide 2 receptor (GLP2R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.