Glucagon-like peptide 1 receptor (Glp1r) Recombinant Protein | Glp1r recombinant protein
Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial
ASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Generally, the shelf life of liquid form is 6 months at -20°C, -80°C. The shelf life of lyophilized form is 12 months at -20°C, -80°C.
Store working aliquots at 4°C for up to one week.
Notes: Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI Description
induces insulin secretion; mediates neuroendocrine signaling of feeding behavior; mediates cardiovascular response and increased blood pressure [RGD, Feb 2006]
Uniprot Description
GLP1R: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.
Protein type: GPCR, family 2; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR
Chromosomal Location of Human Ortholog: 20p12
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; peptide hormone binding; peptide receptor activity; peptide receptor activity, G-protein coupled
Biological Process: associative learning; cAMP-mediated signaling; elevation of cytosolic calcium ion concentration; feeding behavior; G-protein signaling, adenylate cyclase activating pathway; hormone secretion; insulin secretion; learning and/or memory; memory; negative regulation of apoptosis; negative regulation of neuron apoptosis; neuropeptide signaling pathway; positive regulation of blood pressure; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of glucose import; positive regulation of heart contraction; positive regulation of insulin secretion; positive regulation of transcription from RNA polymerase II promoter; regulation of calcium ion transport; regulation of heart contraction; regulation of insulin secretion; release of sequestered calcium ion into cytosol; response to glucose stimulus
Research Articles on Glp1r
Similar Products
Product Notes
The Glp1r glp1r (Catalog #AAA9424050) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial. 22-135aa. The amino acid sequence is listed below: GPRPQGATVS LSETVQKWRE YRHQCQRFLT EAPLLATGLF CNRTFDDYAC WPDGPPGSFV NVSCPWYLPW ASSVLQ GHVYRFCTAE GIWLHKDNSS LPWRDLSECE ESKQGERN. It is sometimes possible for the material contained within the vial of "Glucagon-like peptide 1 receptor (Glp1r), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
