Zinc finger protein GLIS2 (GLIS2) Recombinant Protein | GLIS2 recombinant protein

Recombinant Human Zinc finger protein GLIS2 (GLIS2)

Cat. Num. AAA1403348

• Gene Names: GLIS2; NKL; NPHP7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein GLIS2 (GLIS2); Recombinant Human Zinc finger protein GLIS2 (GLIS2); GLIS2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-524, Full length protein
• Sequence: MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
• Sequence Length: 524

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 974144315
• NCBI GeneID: 84662
• NCBI Accession #: NP_001305847.1
• NCBI GenBank Nucleotide #: NM_001318918.1
• UniProt Accession #: Q9BZE0; B3KX84
• Molecular Weight: 55,689 Da
• NCBI Official Full Name: zinc finger protein GLIS2
• NCBI Official Synonym Full Names: GLIS family zinc finger 2
• NCBI Official Symbol: GLIS2
• NCBI Official Synonym Symbols: NKL; NPHP7
• NCBI Protein Information: zinc finger protein GLIS2
• UniProt Protein Name: Zinc finger protein GLIS2
• Protein Family: Zinc finger protein
• UniProt Gene Name: GLIS2
• UniProt Synonym Gene Names: NKL

NCBI Description

This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear transcription factor with five C2H2-type zinc finger domains. The protein encoded by this gene is widely expressed at low levels in the neural tube and peripheral nervous system and likely promotes neuronal differentiation. It is abundantly expressed in the kidney and may have a role in the regulation of kidney morphogenesis. p120 regulates the expression level of this protein and induces the cleavage of this protein's C-terminal zinc finger domain. This protein also promotes the nuclear translocation of p120. Mutations in this gene cause nephronophthisis (NPHP), an autosomal recessive kidney disease characterized by tubular basement membrane disruption, interstitial lymphohistiocytic cell infiltration, and development of cysts at the corticomedullary border of the kidneys.[provided by RefSeq, Jan 2010]

Uniprot Description

Can act either as a transcriptional repressor or as a transcriptional activator, depending on the cell context. Acts as a repressor of the Hedgehog signaling pathway (). Represses the Hedgehog-dependent expression of Wnt4 (). Necessary to maintain the differentiated epithelial phenotype in renal cells through the inhibition of SNAI1, which itself induces the epithelial-to-mesenchymal transition (). Represses transcriptional activation mediated by CTNNB1 in the Wnt signaling pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation ().