Gap junction gamma-2 protein (GJC2) Recombinant Protein | GJC2 recombinant protein
Recombinant Bovine Gap junction gamma-2 protein (GJC2)
Gene Names
GJC2; GJA12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gap junction gamma-2 protein (GJC2); Recombinant Bovine Gap junction gamma-2 protein (GJC2); GJC2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-429aa; full length protein
Sequence
MTNMSWSFLTRLLEEIHNHSTFVGKVWLTVLVVFRIVLTAVGGESIYSDEQTKFTCNTRQ PGCDNVCYDAFAPLSHVRFWVFQIVVISTPSVMYLGYAVHRLARASQDERRRASRRRPSR RAPRPPLPLPPPPHPGWPEPADLGEEEPMLGLGEEDEDPGVAEGLGEDEEAEDTGAAKGA GGDTKVAGVPGPAGQHDGRRRIQREGLMRVYVAQLVARAAFEVAFLVGQYLLYGFEVRPF FACSRQPCPHVVDCFVSRPTEKTVFLLVMYVVSCLCLLLNLCEMAHLGLGNAQDAVRGRR PLPASPGPMPRPPPCALPAAPSGLACPPDYSLVVRTAEHARAQDQELASLALQALQDRRA LGDLDSPPGPGLPANARGPPKPGAPASGSGSATSGGTVGGQGRQGIKPRMGSEKGSGSSS REGKTTVWI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bovine
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GJC2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,067 Da
NCBI Official Full Name
gap junction gamma-2 protein
NCBI Official Symbol
GJC2
NCBI Official Synonym Symbols
GJA12
NCBI Protein Information
gap junction gamma-2 protein
UniProt Protein Name
Gap junction gamma-2 protein
Protein Family
UniProt Gene Name
GJC2
UniProt Synonym Gene Names
GJA12
UniProt Entry Name
CXG2_BOVIN
Uniprot Description
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a role in myelination in central and peripheral nervous systems ().
Research Articles on GJC2
Similar Products
Product Notes
The GJC2 gjc2 (Catalog #AAA7015746) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-429aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GJC2 gjc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTNMSWSFLT RLLEEIHNHS TFVGKVWLTV LVVFRIVLTA VGGESIYSDE QTKFTCNTRQ PGCDNVCYDA FAPLSHVRFW VFQIVVISTP SVMYLGYAVH RLARASQDER RRASRRRPSR RAPRPPLPLP PPPHPGWPEP ADLGEEEPML GLGEEDEDPG VAEGLGEDEE AEDTGAAKGA GGDTKVAGVP GPAGQHDGRR RIQREGLMRV YVAQLVARAA FEVAFLVGQY LLYGFEVRPF FACSRQPCPH VVDCFVSRPT EKTVFLLVMY VVSCLCLLLN LCEMAHLGLG NAQDAVRGRR PLPASPGPMP RPPPCALPAA PSGLACPPDY SLVVRTAEHA RAQDQELASL ALQALQDRRA LGDLDSPPGP GLPANARGPP KPGAPASGSG SATSGGTVGG QGRQGIKPRM GSEKGSGSSS REGKTTVWI. It is sometimes possible for the material contained within the vial of "Gap junction gamma-2 protein (GJC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
