Gastric intrinsic factor (GIF) Recombinant Protein | GIF recombinant protein
Recombinant Dog Gastric intrinsic factor (GIF)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gastric intrinsic factor (GIF); Recombinant Dog Gastric intrinsic factor (GIF); GIF recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-417, Full length protein
Sequence
RSSCSVPQAAQHLVDGLQVLLEDSVSSAAPPNPSVLIAMNLAGALSAEARELLADRLGASDSAGLSVGQLALTIMALNSSCRDPGNKVSVLYGQMEAWPPSSPSAPAWTFYGPSLAVLALCQEHPGRALPVAARLAKILAAGLSPFNTDTGAMVTLALTCMYNKIPEGSEEGYRTLFSQVLKDVVENISMRIKDNGIIGDVYSTGLAMQALSVTPEPPNKEWDCKKTMDTILKEIEQGKFHNPMSIAQILPSLKGKTYLDVPYVSCSPGHQVQPTLPSQPSPVPTSASNITVAYTINNQLKGVELVFNETIDVSVKDGSVLLVVLEEAQRRNPMFKFVTTMTSWGLVVSSINNIAESVHDRTYWQFLSGKTPLNEGVADYTPRDHEHITANFTQY
Sequence Length
395
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GIF recombinant protein
This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,982 Da
NCBI Official Full Name
gastric intrinsic factor
NCBI Official Synonym Full Names
gastric intrinsic factor
NCBI Official Symbol
GIF
NCBI Protein Information
gastric intrinsic factor
UniProt Protein Name
Gastric intrinsic factor
Protein Family
UniProt Gene Name
GIF
UniProt Synonym Gene Names
IF; INF
Uniprot Description
Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis ().
Similar Products
Product Notes
The GIF gif (Catalog #AAA1348792) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-417, Full length protein. The amino acid sequence is listed below: RSSCSVPQAA QHLVDGLQVL LEDSVSSAAP PNPSVLIAMN LAGALSAEAR ELLADRLGAS DSAGLSVGQL ALTIMALNSS CRDPGNKVSV LYGQMEAWPP SSPSAPAWTF YGPSLAVLAL CQEHPGRALP VAARLAKILA AGLSPFNTDT GAMVTLALTC MYNKIPEGSE EGYRTLFSQV LKDVVENISM RIKDNGIIGD VYSTGLAMQA LSVTPEPPNK EWDCKKTMDT ILKEIEQGKF HNPMSIAQIL PSLKGKTYLD VPYVSCSPGH QVQPTLPSQP SPVPTSASNI TVAYTINNQL KGVELVFNET IDVSVKDGSV LLVVLEEAQR RNPMFKFVTT MTSWGLVVSS INNIAESVHD RTYWQFLSGK TPLNEGVADY TPRDHEHITA NFTQY. It is sometimes possible for the material contained within the vial of "Gastric intrinsic factor (GIF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
