Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Growth hormone-releasing hormone receptor (Ghrhr) Recombinant Protein | Ghrhr recombinant protein

Recombinant Mouse Growth hormone-releasing hormone receptor (Ghrhr)

Gene Names
Ghrhr; lit; Ghrfr; little
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth hormone-releasing hormone receptor (Ghrhr); Recombinant Mouse Growth hormone-releasing hormone receptor (Ghrhr); Recombinant Growth hormone-releasing hormone receptor (Ghrhr); Growth hormone-releasing hormone receptor; GHRH receptor; Growth hormone-releasing factor receptor; GRF receptor; GRFR; Ghrhr recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-423
Sequence
HLHLECDFITQLRDDELACLQAAEGTNNTSLGCPGTWDGLLCWPPTGSGQWVSLPCPEFFSHFGSDTGFVKRDCTITGWSNPFPPYPVACPVPLELLTKEKSYFSTVKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVFLKDAAIFQGDSTDHCSMSTVLCKVSVAISHLATMTNFSWLLAEAVYLSCLLASTSPRSKPAFWWLVLAGWGLPVLCTGTWVGCKLAFEDTECWDLDNSSPCWWIIKGPIVLSVGVNFGLFLNIICILLRKLEPAQGGLHTRAQYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLDIRVPLELGLGSFQGFIVAVLYCFLNQEVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRLKVLTSEC
Sequence Length
423
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,004 Da
NCBI Official Full Name
growth hormone-releasing hormone receptor
NCBI Official Synonym Full Names
growth hormone releasing hormone receptor
NCBI Official Symbol
Ghrhr
NCBI Official Synonym Symbols
lit; Ghrfr; little
NCBI Protein Information
growth hormone-releasing hormone receptor; GRFR; GRF receptor; GHRH receptor; growth hormone-releasing factor receptor
UniProt Protein Name
Growth hormone-releasing hormone receptor
UniProt Gene Name
Ghrhr
UniProt Synonym Gene Names
Grfr; GHRH receptor; GRF receptor; GRFR
UniProt Entry Name
GHRHR_MOUSE

Uniprot Description

GHRHR: Receptor for GRF, coupled to G proteins which activate adenylyl cyclase. Stimulates somatotroph cell growth, growth hormone gene transcription and growth hormone secretion. Defects in GHRHR are a cause of growth hormone deficiency isolated type 1B (IGHD1B); also known as dwarfism of Sindh. IGHD1B is an autosomal recessive deficiency of GH which causes short stature. IGHD1B patients have low but detectable levels of GH. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, integral; Cell development/differentiation; Receptor, GPCR; Membrane protein, multi-pass

Cellular Component: nuclear outer membrane; cell surface; nuclear matrix; membrane; cell; cytoplasm; integral to membrane; plasma membrane; nuclear inner membrane; secretory granule

Molecular Function: G-protein coupled receptor activity; protein binding; signal transducer activity; transmembrane receptor activity; growth factor binding; peptide hormone binding; growth hormone-releasing hormone receptor activity

Biological Process: lactation; regulation of insulin-like growth factor receptor signaling pathway; regulation of protein metabolic process; response to glucocorticoid stimulus; cell maturation; determination of adult life span; positive regulation of multicellular organism growth; signal transduction; G-protein signaling, adenylate cyclase activating pathway; response to insulin stimulus; water homeostasis; growth hormone secretion; cAMP-mediated signaling; cell surface receptor linked signal transduction; mammary gland development; positive regulation of cell proliferation; positive regulation of cAMP biosynthetic process; somatotropin secreting cell development; adenohypophysis development; regulation of steroid hormone receptor signaling pathway; adenylate cyclase activation; positive regulation of hormone secretion; positive regulation of cAMP metabolic process; positive regulation of growth hormone secretion; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein coupled receptor protein signaling pathway; cellular response to insulin stimulus; response to estrogen stimulus; hormone metabolic process

Research Articles on Ghrhr

Similar Products

Product Notes

The Ghrhr ghrhr (Catalog #AAA956314) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-423. The amino acid sequence is listed below: HLHLECDFIT QLRDDELACL QAAEGTNNTS LGCPGTWDGL LCWPPTGSGQ WVSLPCPEFF SHFGSDTGFV KRDCTITGWS NPFPPYPVAC PVPLELLTKE KSYFSTVKII YTTGHSISIV ALCVAIAILV ALRRLHCPRN YIHTQLFATF ILKASAVFLK DAAIFQGDST DHCSMSTVLC KVSVAISHLA TMTNFSWLLA EAVYLSCLLA STSPRSKPAF WWLVLAGWGL PVLCTGTWVG CKLAFEDTEC WDLDNSSPCW WIIKGPIVLS VGVNFGLFLN IICILLRKLE PAQGGLHTRA QYWRLSKSTL LLIPLFGIHY IIFNFLPDSA GLDIRVPLEL GLGSFQGFIV AVLYCFLNQE VRTEISRKWY GHDPELLPAR RTCTEWTTPP RSRLKVLTSE C. It is sometimes possible for the material contained within the vial of "Growth hormone-releasing hormone receptor (Ghrhr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.