Vitamin K-dependent gamma-carboxylase (GGCX) Recombinant Protein | GGCX recombinant protein
Recombinant Sheep Vitamin K-dependent gamma-carboxylase (GGCX)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vitamin K-dependent gamma-carboxylase (GGCX); Recombinant Sheep Vitamin K-dependent gamma-carboxylase (GGCX); GGCX recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-758aa; full length protein
Sequence
AVSARPARAPRGPDKVKKDKAAQTSGPRQGSQMGKLLGFEWTDVSSWERLVTLLNRPTDP ASLAVFRFLFGLMMVLDIPQERGLSSLDRRYLDGLEVCRFPLLDALQPLPLDWMYLVYTI MFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFVDAHHYWS VDGLLRARKRNAHVPLWNYAVLRGQIFIVYFIAGIKKLDADWVEGYSMEYLSRHWLFSPF KLVLSEEMTSLLVVHWCGLLLDLSAGFLLFFDASRPIGFVFVSYFHCMNSQLFSIGMFPY VMLASSPLFCSPEWPRKLVAHCPKKLQELLPLRTAPQPSTSCMYKRSRARGSQKPGLRHQ LSTAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTG ELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRI FDPRVDIVQAAWSPFQRTPWLQPLLMDLSPWRTKLQEIKSSLDNHTEVVFIADFPGLHLE NFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLQEGEKMQLPAGEYHKVYTVSSSPSCYMY IYVNTTEVALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLR RQQRLQEIERRRNAPFYERFVRFLLRKLFIFRRSFLMTCISLRNLALGRPSLEQLAQEVT YANLRPFEPAGEPSPVNTDSSNPNPPEPDSHPVHSEF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Sheep
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GGCX recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,581 Da
NCBI Official Full Name
vitamin K-dependent gamma-carboxylase
NCBI Official Symbol
GGCX
NCBI Protein Information
vitamin K-dependent gamma-carboxylase
UniProt Protein Name
Vitamin K-dependent gamma-carboxylase
Protein Family
UniProt Gene Name
GGCX
UniProt Entry Name
VKGC_SHEEP
Uniprot Description
Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide.
Similar Products
Product Notes
The GGCX ggcx (Catalog #AAA7015621) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-758aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GGCX ggcx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AVSARPARAP RGPDKVKKDK AAQTSGPRQG SQMGKLLGFE WTDVSSWERL VTLLNRPTDP ASLAVFRFLF GLMMVLDIPQ ERGLSSLDRR YLDGLEVCRF PLLDALQPLP LDWMYLVYTI MFLGALGMML GLCYRISCVL FLLPYWYVFL LDKTSWNNHS YLYGLLAFQL TFVDAHHYWS VDGLLRARKR NAHVPLWNYA VLRGQIFIVY FIAGIKKLDA DWVEGYSMEY LSRHWLFSPF KLVLSEEMTS LLVVHWCGLL LDLSAGFLLF FDASRPIGFV FVSYFHCMNS QLFSIGMFPY VMLASSPLFC SPEWPRKLVA HCPKKLQELL PLRTAPQPST SCMYKRSRAR GSQKPGLRHQ LSTAFTLLYL LEQLFLPYSH FLTQGYNNWT NGLYGYSWDM MVHSRSHQHV KITYRDGRTG ELGYLNPGVF TQSRRWKDHA DMLKQYATCL SRLLPKYNVT EPQIYFDIWV SINDRFQQRI FDPRVDIVQA AWSPFQRTPW LQPLLMDLSP WRTKLQEIKS SLDNHTEVVF IADFPGLHLE NFVSEDLGNT SIQLLQGEVT VELVAEQKNQ TLQEGEKMQL PAGEYHKVYT VSSSPSCYMY IYVNTTEVAL EQDLAYLQEL KEKVENGSET GPLPPELQPL LEGEVKGGPE PTPLVQTFLR RQQRLQEIER RRNAPFYERF VRFLLRKLFI FRRSFLMTCI SLRNLALGRP SLEQLAQEVT YANLRPFEPA GEPSPVNTDS SNPNPPEPDS HPVHSEF. It is sometimes possible for the material contained within the vial of "Vitamin K-dependent gamma-carboxylase (GGCX), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
