Uncharacterized protein gfcC (gfcC) Recombinant Protein | gfcC recombinant protein
Recombinant Escherichia coli Uncharacterized protein gfcC (gfcC)
Gene Names
gfcC; ECK0976; JW0968; ymcB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Uncharacterized protein gfcC (gfcC); Recombinant Escherichia coli Uncharacterized protein gfcC (gfcC); gfcC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-248, full length protein
Sequence
QGTVTIYLPGEQQTLSVGPVENVVQLVTQPQLRDRLWWPGALLTDSAAKAKALKDYQHVMAQLASWEAEADDDVAATIKSVRQQLLNLNITGRLPVKLDPDFVRVDENSNPPLVGDYTLYTVQRPVTITLLGAVSGAGQLPWQAGRSVTDYLQDHPRLAGADKNNVMVITPEGETVVAPVALWNKRHVEPPPGSQLWLGFSAHVLPEKYADLNDQIVSVLTQRVPD
Sequence Length
226
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,296 Da
NCBI Official Full Name
putative O-antigen capsule production periplasmic protein
NCBI Official Symbol
gfcC
NCBI Official Synonym Symbols
ECK0976; JW0968; ymcB
NCBI Protein Information
putative O-antigen capsule production periplasmic protein
UniProt Protein Name
Uncharacterized protein GfcC
UniProt Gene Name
gfcC
UniProt Synonym Gene Names
ymcB
NCBI Description
Function characterized in enteropathogenic Escherichia coli (EPEC). [More information is available at EcoGene: EG13730]. The operon encoding YmcD, YmcC, YmcB, YmcA, YzzZ, Etp, and Etk was characterized in the enteropathogenic Escherichia coli strain O127:H6. [More information is available at EcoCyc: G6506].
Uniprot Description
Enzyme and pathway databasesBioCyc Collection of Pathway/Genome DatabasesMore...BioCyciEcoCyc:G6506-MONOMER.
Similar Products
Product Notes
The gfcC gfcc (Catalog #AAA1080595) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-248, full length protein. The amino acid sequence is listed below: QGTVTIYLPG EQQTLSVGPV ENVVQLVTQP QLRDRLWWPG ALLTDSAAKA KALKDYQHVM AQLASWEAEA DDDVAATIKS VRQQLLNLNI TGRLPVKLDP DFVRVDENSN PPLVGDYTLY TVQRPVTITL LGAVSGAGQL PWQAGRSVTD YLQDHPRLAG ADKNNVMVIT PEGETVVAPV ALWNKRHVEP PPGSQLWLGF SAHVLPEKYA DLNDQIVSVL TQRVPD. It is sometimes possible for the material contained within the vial of "Uncharacterized protein gfcC (gfcC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
