Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Golgi to ER traffic protein 1 (GET1) Recombinant Protein | PGUG_02080 recombinant protein

Recombinant Meyerozyma guilliermondii Golgi to ER traffic protein 1 (GET1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi to ER traffic protein 1 (GET1); Recombinant Meyerozyma guilliermondii Golgi to ER traffic protein 1 (GET1); Recombinant Golgi to ER traffic protein 1 (GET1); Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1; PGUG_02080 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-200
Sequence
MEPYTLLLFIFVIQIVKQIISAVGKQSIESISWVLYCRVAPKFGHSKLASMSQKSSQLRTVAGERRAVSAQDQYAKWTKLNRQHDKLVAEIEQLQKEVDLDKVKVNTFTGYLIAILTSIPIWFFRVWYRSVVLFYFPPGILPRALEWSIALPFTVTGGVSLTVWMMAAGAVASSLTFLFMFPFEKAVPKPVLAKKSPQQL
Sequence Length
250
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,660 Da
NCBI Official Full Name
hypothetical protein PGUG_02080
NCBI Official Symbol
PGUG_02080
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Golgi to ER traffic protein 1
UniProt Gene Name
GET1
UniProt Entry Name
GET1_PICGU

Uniprot Description

Function: Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET2, acts as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. The GET complex cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER

By similarity.

Subunit structure: Component of the Golgi to ER traffic (GET) complex, which is composed of GET1, GET2 and GET3

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the WRB/GET1 family.

Sequence caution: The sequence EDK37982.2 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The PGUG_02080 get1 (Catalog #AAA1238658) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-200. The amino acid sequence is listed below: MEPYTLLLFI FVIQIVKQII SAVGKQSIES ISWVLYCRVA PKFGHSKLAS MSQKSSQLRT VAGERRAVSA QDQYAKWTKL NRQHDKLVAE IEQLQKEVDL DKVKVNTFTG YLIAILTSIP IWFFRVWYRS VVLFYFPPGI LPRALEWSIA LPFTVTGGVS LTVWMMAAGA VASSLTFLFM FPFEKAVPKP VLAKKSPQQL. It is sometimes possible for the material contained within the vial of "Golgi to ER traffic protein 1 (GET1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.