Protein get1 (get1) Recombinant Protein | PMAA_027540 recombinant protein
Recombinant Penicillium marneffei Protein get1 (get1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein get1 (get1); Recombinant Penicillium marneffei Protein get1 (get1); Recombinant Protein get1 (get1); Protein get1; Guided entry of tail-anchored proteins 1; PMAA_027540 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-203
Sequence
MISFLLLIFLIQLAIYIVNTIGSSTIDDLLWILYLRLPMPISKDTRKHGELKHDVVQLKREMNATSSQDEFAKWAKLRRRHDKAMEEYEAMNRSMGSRKTSFQFSIKIARWLTLNGPRLFIQFYYTKTPVFDLPAGWFPYPVEWILSFPRAPLGSVSIQVWSSACATAISLAGDVVIAVVQRRQASNRQAQAVPAGKSEAATK
Sequence Length
203
Species
Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,109 Da
NCBI Official Full Name
retrograde vesicle-mediated transport protein Get1, putative
NCBI Official Symbol
PMAA_027540
NCBI Protein Information
retrograde vesicle-mediated transport protein Get1, putative
UniProt Protein Name
Protein get1
UniProt Gene Name
get1
UniProt Entry Name
GET1_PENMQ
Uniprot Description
Function: Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol
By similarity.
Subunit structure: Interacts with get3
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the WRB/GET1 family.
Similar Products
Product Notes
The PMAA_027540 get1 (Catalog #AAA1105845) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-203. The amino acid sequence is listed below: MISFLLLIFL IQLAIYIVNT IGSSTIDDLL WILYLRLPMP ISKDTRKHGE LKHDVVQLKR EMNATSSQDE FAKWAKLRRR HDKAMEEYEA MNRSMGSRKT SFQFSIKIAR WLTLNGPRLF IQFYYTKTPV FDLPAGWFPY PVEWILSFPR APLGSVSIQV WSSACATAIS LAGDVVIAVV QRRQASNRQA QAVPAGKSEA ATK. It is sometimes possible for the material contained within the vial of "Protein get1 (get1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
