Ganglioside-induced differentiation-associated protein 1-like 1 (Gdap1l1) Recombinant Protein | Gdap1l1 recombinant protein
Recombinant Mouse Ganglioside-induced differentiation-associated protein 1-like 1 (Gdap1l1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ganglioside-induced differentiation-associated protein 1-like 1 (Gdap1l1); Recombinant Mouse Ganglioside-induced differentiation-associated protein 1-like 1 (Gdap1l1); Gdap1l1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-370, full length protein
Sequence
MATPNNLTPTNCSWWPISALESDAAKPVETPDAPEASSPAHWPKESLVLYHWTQSFSSQKRLQVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYWYLKKKYI
Sequence Length
370
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Gdap1l1 recombinant protein
The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. This protein is similar in sequence to the human GDAP1 protein.
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
42,318 Da
NCBI Official Full Name
Ganglioside-induced differentiation-associated protein 1-like 1
UniProt Protein Name
Ganglioside-induced differentiation-associated protein 1-like 1
Protein Family
UniProt Gene Name
Gdap1l1
UniProt Synonym Gene Names
Gdap1l; GDAP1-L1
Similar Products
Product Notes
The Gdap1l1 gdap1l1 (Catalog #AAA1416912) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-370, full length protein. The amino acid sequence is listed below: MATPNNLTPT NCSWWPISAL ESDAAKPVET PDAPEASSPA HWPKESLVLY HWTQSFSSQK RLQVRLVIAE KGLACEERDV SLPQSEHKEP WFMRLNLGEE VPVIIHRDNI ISDYDQIIDY VERTFTGEHV VALMPEAGSP QHARVLQYRE LLDALPMDAY THGCILHPEL TTDSMIPKYA TAEIRRHLAN ATTDLMKLDH EEEPQLSEPY LSKQKKLMAK ILEHDDVSYL KKILGELAMV LDQIEAELEK RKLENEGQTC ELWLCGCAFT LADVLLGATL HRLKFLGLSK KYWEDGSRPN LQSFFERVQR RFAFRKVLGD IHTTLLSAVI PNAFRLVKRK PPSFFGASFL MGSLGGMGYF AYWYLKKKYI. It is sometimes possible for the material contained within the vial of "Ganglioside-induced differentiation-associated protein 1-like 1 (Gdap1l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
