Ganglioside-induced differentiation-associated protein 1 (Gdap1) Recombinant Protein | Gdap1 recombinant protein
Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (Gdap1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ganglioside-induced differentiation-associated protein 1 (Gdap1); Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (Gdap1); Recombinant Ganglioside-induced differentiation-associated protein 1 (Gdap1); Ganglioside-induced differentiation-associated protein 1; GDAP1; Gdap1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-358
Sequence
MARRQDEARAGVPLRVEGPPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGSTLVVGLLVGMGYFAFMLFRRRLGSMILALRPRPNYF
Sequence Length
358
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,311 Da
NCBI Official Full Name
ganglioside-induced differentiation-associated protein 1
NCBI Official Synonym Full Names
ganglioside-induced differentiation-associated-protein 1
NCBI Official Symbol
Gdap1
NCBI Protein Information
ganglioside-induced differentiation-associated protein 1
UniProt Protein Name
Ganglioside-induced differentiation-associated protein 1
Protein Family
UniProt Gene Name
Gdap1
UniProt Synonym Gene Names
GDAP1
UniProt Entry Name
GDAP1_MOUSE
Uniprot Description
GDAP1: the ganglioside-induced differentiation associated protein-1 gene causes autosomal recessive demyelinating or axonal Charcot-Marie-Tooth neuropathy (CMT).
Protein type: Membrane protein, multi-pass
Cellular Component: mitochondrial outer membrane; membrane; mitochondrion; cytoplasm; integral to membrane; nucleus; integral to mitochondrial outer membrane
Biological Process: mitochondrial fission; response to retinoic acid; protein targeting to mitochondrion
Research Articles on Gdap1
Similar Products
Product Notes
The Gdap1 gdap1 (Catalog #AAA1071785) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-358. The amino acid sequence is listed below: MARRQDEARA GVPLRVEGPP DKEVHLILYH WTHSFSSQKV RLVIAEKALK CEEHDVSLPL SEHNEPWFMR LNSAGEVPVL VHGENIICEA TQIIDYLEQT FLDERTPRLM PDEGSMYYPR VQHYRELLDS LPMDAYTHGC ILHPELTVDS MIPAYATTRI RSQIGNTESE LKKLAEENPD LQEAYIAKQK RLKSKLLDHD NVKYLKKILD ELEKVLDQVE TELQRRNEET PEEGNQPWLC GESFTLADVS LAVTLHRLKF LGFARRNWGH GKRPNLETYY ERVLKRKTFN KVLGHVNNIL ISAVLPTAFR VAKKRAPKVL GSTLVVGLLV GMGYFAFMLF RRRLGSMILA LRPRPNYF. It is sometimes possible for the material contained within the vial of "Ganglioside-induced differentiation-associated protein 1 (Gdap1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
