Glucagon (GCG) Recombinant Protein | GCG recombinant protein

Recombinant Human Glucagon (GCG), partial

Cat. Num. AAA949617

• Gene Names: GCG; GLP1; GLP2; GRPP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glucagon (GCG); Recombinant Human Glucagon (GCG); partial; Incretin hormone; Glucagon-like peptide 1(7-37); GLP-1(7-37); Glucagon-like peptide 1(7-36); GLP-1(7-36); Glucagon-like peptide 2; GLP-2; GCG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 53-89aa; Partial (Oxyntomodulin peptide)
• Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for GCG recombinant protein

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycia. Plays an important role in initiating and maintaining hyperglycic conditions in diabetes. GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis. GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability. Oxyntomodulin significantly reduces food intake. Inhibits gastric ptying in humans. Suppression of gastric ptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness. Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Product Categories/Family for GCG recombinant protein

Metabolism

References

Glucagon gene expression in vertebrate brain.Drucker D.J., Asa S.J. Biol. Chem. 263:13475-13478(1988)

NCBI and Uniprot Product Information

• NCBI GI #: 4503945
• NCBI GeneID: 2641
• NCBI Accession #: NP_002045.1
• NCBI GenBank Nucleotide #: NM_002054.4
• UniProt Accession #: P01275; Q53TP6; A6NN65
• Molecular Weight: 30.4 kDa
• NCBI Official Full Name: glucagon preproprotein
• NCBI Official Synonym Full Names: glucagon
• NCBI Official Symbol: GCG
• NCBI Official Synonym Symbols: GLP1; GLP2; GRPP
• NCBI Protein Information: glucagon
• UniProt Protein Name: Glucagon
• Protein Family: Glucagon
• UniProt Gene Name: GCG
• UniProt Synonym Gene Names: GRPP; OXM; OXY; GLP-1; GLP-1(7-37); GLP-1(7-36); GLP-2
• UniProt Entry Name: GLUC_HUMAN

NCBI Description

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008]

Uniprot Description

GCG: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion. Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain. Belongs to the glucagon family.

Protein type: Secreted, signal peptide; Secreted; Hormone

Chromosomal Location of Human Ortholog: 2q36-q37

Cellular Component: endoplasmic reticulum lumen; extracellular region; extracellular space; plasma membrane

Molecular Function: glucagon receptor binding; hormone activity; identical protein binding; protein binding; receptor binding

Biological Process: cell proliferation; cellular protein metabolic process; energy reserve metabolic process; feeding behavior; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; negative regulation of apoptosis; negative regulation of appetite; positive regulation of cAMP biosynthetic process; positive regulation of histone H3-K4 methylation; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein binding; positive regulation of protein kinase activity; regulation of insulin secretion; response to starvation; signal transduction