Glutamyl-tRNA (Gln) amidotransferase subunit B, mitochondrial (PET112) Recombinant Protein | PET112 recombinant protein
Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit B, mitochondrial (PET112)
Gene Names
GATB; PET112; HSPC199; PET112L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamyl-tRNA (Gln) amidotransferase subunit B; mitochondrial (PET112); Recombinant Human Glutamyl-tRNA (Gln) amidotransferase subunit B; PET112 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-557, Full length protein
Sequence
PTGSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLFSGSQVRFSAPPNSLVSFFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLIYGVCAGKKQSQVIPKTVRIKQIQLEQDSGKSLHDNLRSQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL
Sequence Length
527
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,864 Da
NCBI Official Full Name
glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
NCBI Official Synonym Full Names
glutamyl-tRNA amidotransferase subunit B
NCBI Official Symbol
GATB
NCBI Official Synonym Symbols
PET112; HSPC199; PET112L
NCBI Protein Information
glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
UniProt Protein Name
Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
UniProt Gene Name
GATB
UniProt Synonym Gene Names
Glu-AdT subunit B
Uniprot Description
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Research Articles on PET112
Similar Products
Product Notes
The PET112 gatb (Catalog #AAA1015523) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-557, Full length protein. The amino acid sequence is listed below: PTGSTSNQIR GESSVAQQPL HTAQKTRKGE HKWAAVVGLE IHAQISSNSK LFSGSQVRFS APPNSLVSFF DASLPGTLPV LNRRCVEAAV MTGLALNCHI NKKSLFDRKH YFYADLPAGY QITQQRLPIA VNGSLIYGVC AGKKQSQVIP KTVRIKQIQL EQDSGKSLHD NLRSQTLIDL NRAGVGLLEV VLEPDMSCGE EAATAVRELQ LILQALGTSQ ANMAEGQLRV DANISVHHPG EPLGVRTEVK NLNSIRFLAK AIDYEIQRQI NELENGGEIL NETRSFHHKL GCTMSMRDKE GKQDYRFMPE PNLPPLVLYD ATSLPAGADP QQVINIDQIR ETLPELPSVT REKLVQQYGM LLEHSFTLLN EVGLLEFFQN VIKETRAEPK KVTSWVLNTF LGYLKQQNLA VSESPVTPSA LAELLDLLDS RTISSSAAKQ VFEELWKREG KTPGQIVSEK QLELMQDQGA LEQLCHSVME AHPQVVMDVK NRNPRAINKL IGLVRKATQS RADPVMIKEI LEKKLSL. It is sometimes possible for the material contained within the vial of "Glutamyl-tRNA (Gln) amidotransferase subunit B, mitochondrial (PET112), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
