GATA-binding factor 2 (GATA2) Recombinant Protein | GATA2 recombinant protein
Recombinant Chicken GATA-binding factor 2 (GATA2)
Gene Names
GATA2; GATA-2; NF-E1b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GATA-binding factor 2 (GATA2); Recombinant Chicken GATA-binding factor 2 (GATA2); GATA2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-466, Full length protein
Sequence
MEVATDQPRWMTHHAVLNGQHPESHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANSAHARARVSYSQAHARLTGSQMCRPHLIHSPGIPWLDSSKAALSAHHHNPWTVNPFTKTPLHPSAAGAPGAISVYPGSSTSSTASVSSLTPASHSGSHLFGFPPTPPKEVSPDPNSTSAASPSSSAGARQEDKDSIKYQVSLSEGMKMESASPLRSSLTSMGAQPSTHHPIPTYPSYVPAAHDYSSSLFHPGSFLGGPASSFTPKPRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGSECFEELSKCMQEKSSPFSAAALASHMAPMGHLPPFSHSGHILPTPTPIHPSSSISFGHPHPSSMVTAMG
Sequence Length
466
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,150 Da
NCBI Official Full Name
GATA-binding factor 2
NCBI Official Synonym Full Names
GATA binding protein 2
NCBI Official Symbol
GATA2
NCBI Official Synonym Symbols
GATA-2; NF-E1b
NCBI Protein Information
GATA-binding factor 2
UniProt Protein Name
GATA-binding factor 2
Protein Family
UniProt Gene Name
GATA2
UniProt Synonym Gene Names
GATA-2
Uniprot Description
Transcriptional activator which probably serves as a general switch factor for cell-specific development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of genes.
Research Articles on GATA2
Similar Products
Product Notes
The GATA2 gata2 (Catalog #AAA950743) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-466, Full length protein. The amino acid sequence is listed below: MEVATDQPRW MTHHAVLNGQ HPESHHPGLA HNYMEPAQLL PPDEVDVFFN HLDSQGNPYY ANSAHARARV SYSQAHARLT GSQMCRPHLI HSPGIPWLDS SKAALSAHHH NPWTVNPFTK TPLHPSAAGA PGAISVYPGS STSSTASVSS LTPASHSGSH LFGFPPTPPK EVSPDPNSTS AASPSSSAGA RQEDKDSIKY QVSLSEGMKM ESASPLRSSL TSMGAQPSTH HPIPTYPSYV PAAHDYSSSL FHPGSFLGGP ASSFTPKPRS KARSCSEGRE CVNCGATATP LWRRDGTGHY LCNACGLYHK MNGQNRPLIK PKRRLSAARR AGTCCANCQT TTTTLWRRNA NGDPVCNACG LYYKLHNVNR PLTMKKEGIQ TRNRKMSNKS KKSKKGSECF EELSKCMQEK SSPFSAAALA SHMAPMGHLP PFSHSGHILP TPTPIHPSSS ISFGHPHPSS MVTAMG. It is sometimes possible for the material contained within the vial of "GATA-binding factor 2 (GATA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
