Erythroid transcription factor (GATA1) Recombinant Protein | GATA1 recombinant protein
Recombinant Chicken Erythroid transcription factor (GATA1)
Gene Names
GATA1; ERYF1; GATA-1; NF-E1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Erythroid transcription factor (GATA1); Recombinant Chicken Erythroid transcription factor (GATA1); GATA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-304, Full length protein
Sequence
MEFVALGGPDAGSPTPFPDEAGAFLGLGGGERTEAGGLLASYPPSGRVSLVPWADTGTLGTPQWVPPATQMEPPHYLELLQPPRGSPPHPSSGPLLPLSSGPPPCEARECVNCGATATPLWRRDGTGHYLCNACGLYHRLNGQNRPLIRPKKRLLVSKRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPPPPPPPAAAPPQSDALYALGPVVLSGHFLPFGNSGGFFGGGAGGYTAPPGLSPQI
Sequence Length
304
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GATA1 recombinant protein
This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,417 Da
NCBI Official Full Name
erythroid transcription factor
NCBI Official Synonym Full Names
GATA binding protein 1 (globin transcription factor 1)
NCBI Official Symbol
GATA1
NCBI Official Synonym Symbols
ERYF1; GATA-1; NF-E1a
NCBI Protein Information
erythroid transcription factor; LOW QUALITY PROTEIN: erythroid transcription factor-like
UniProt Protein Name
Erythroid transcription factor
Protein Family
UniProt Gene Name
GATA1
UniProt Synonym Gene Names
ERYF1; GATA-1; NF-E1a
Uniprot Description
Transcriptional activator or repressor which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells.
Research Articles on GATA1
Similar Products
Product Notes
The GATA1 gata1 (Catalog #AAA960195) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-304, Full length protein. The amino acid sequence is listed below: MEFVALGGPD AGSPTPFPDE AGAFLGLGGG ERTEAGGLLA SYPPSGRVSL VPWADTGTLG TPQWVPPATQ MEPPHYLELL QPPRGSPPHP SSGPLLPLSS GPPPCEAREC VNCGATATPL WRRDGTGHYL CNACGLYHRL NGQNRPLIRP KKRLLVSKRA GTVCSNCQTS TTTLWRRSPM GDPVCNACGL YYKLHQVNRP LTMRKDGIQT RNRKVSSKGK KRRPPGGGNP SATAGGGAPM GGGGDPSMPP PPPPPAAAPP QSDALYALGP VVLSGHFLPF GNSGGFFGGG AGGYTAPPGL SPQI. It is sometimes possible for the material contained within the vial of "Erythroid transcription factor (GATA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
