Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (GAPB) Recombinant Protein | GAPB recombinant protein
Recombinant Arabidopsis thaliana Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (GAPB)
Gene Names
GAPB; F13A11.3; F13A11_3; glyceraldehyde-3-phosphate dehydrogenase B subunit; GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE B SUBUNIT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glyceraldehyde-3-phosphate dehydrogenase B; chloroplastic (GAPB); Recombinant Arabidopsis thaliana Glyceraldehyde-3-phosphate dehydrogenase B; GAPB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
81-447, Full length protein
Sequence
KLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD
Sequence Length
367
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,660 Da
NCBI Official Full Name
glyceraldehyde-3-phosphate dehydrogenase B subunit
NCBI Official Symbol
GAPB
NCBI Official Synonym Symbols
F13A11.3; F13A11_3; glyceraldehyde-3-phosphate dehydrogenase B subunit; GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE B SUBUNIT
NCBI Protein Information
glyceraldehyde-3-phosphate dehydrogenase B subunit
UniProt Protein Name
Glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic
Protein Family
UniProt Gene Name
GAPB
NCBI Description
Encodes chloroplast localized glyceraldehyde-3-phosphate dehydrogenase that can use both NADH and NADPH to reduce 1,3-diphosphate glycerate. It forms A2B2 heterotetramers with GapA forms of the GADPH enzyme. These complexes are active in the light under reducing conditions, but show reduced NADPH-dependent activity in response to oxidized thioredoxins and increased NAD(H)/NADP(H) ratios due to the formation of inactive A8B8 hexadecamers.
Uniprot Description
Involved in the photosynthetic reductive pentose phosphate pathway (Calvin-Benson cycle). Catalyzes the reduction of 1,3-diphosphoglycerate by NADPH ().
Similar Products
Product Notes
The GAPB gapb (Catalog #AAA1065074) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 81-447, Full length protein. The amino acid sequence is listed below: KLKVAINGFG RIGRNFLRCW HGRKDSPLEV VVLNDSGGVK NASHLLKYDS MLGTFKAEVK IVDNETISVD GKLIKVVSNR DPLKLPWAEL GIDIVIEGTG VFVDGPGAGK HIQAGASKVI ITAPAKGADI PTYVMGVNEQ DYGHDVANII SNASCTTNCL APFAKVLDEE FGIVKGTMTT THSYTGDQRL LDASHRDLRR ARAAALNIVP TSTGAAKAVS LVLPQLKGKL NGIALRVPTP NVSVVDLVIN VEKKGLTAED VNEAFRKAAN GPMKGILDVC DAPLVSVDFR CSDVSTTIDS SLTMVMGDDM VKVVAWYDNE WGYSQRVVDL AHLVASKWPG AEAVGSGDPL EDFCKTNPAD EECKVYD. It is sometimes possible for the material contained within the vial of "Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (GAPB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
