Growth arrest and DNA damage-inducible proteins-interacting protein 1 (GADD45GIP1) Recombinant Protein | GADD45GIP1 recombinant protein

Recombinant Human Growth arrest and DNA damage-inducible proteins-interacting protein 1 (GADD45GIP1)

Cat. Num. AAA1293448

• Gene Names: GADD45GIP1; PRG6; CRIF1; PLINP; CKBBP2; Plinp1; MRP-L59; PLINP-1; CKbetaBP2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Growth arrest and DNA damage-inducible proteins-interacting protein 1 (GADD45GIP1); Recombinant Human Growth arrest and DNA damage-inducible proteins-interacting protein 1 (GADD45GIP1); GADD45GIP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-222, Full length protein
• Sequence: MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
• Sequence Length: 222

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 31543415
• NCBI GeneID: 90480
• NCBI Accession #: NP_443082.2
• NCBI GenBank Nucleotide #: NM_052850.3
• UniProt Accession #: Q8TAE8; Q8IVM3; Q8TE51; Q969P9; Q9BSM6
• Molecular Weight: 25,384 Da
• NCBI Official Full Name: growth arrest and DNA damage-inducible proteins-interacting protein 1
• NCBI Official Synonym Full Names: GADD45G interacting protein 1
• NCBI Official Symbol: GADD45GIP1
• NCBI Official Synonym Symbols: PRG6; CRIF1; PLINP; CKBBP2; Plinp1; MRP-L59; PLINP-1; CKbetaBP2
• NCBI Protein Information: growth arrest and DNA damage-inducible proteins-interacting protein 1
• UniProt Protein Name: Growth arrest and DNA damage-inducible proteins-interacting protein 1
• Protein Family: Growth arrest and DNA damage-inducible protein
• UniProt Gene Name: GADD45GIP1
• UniProt Synonym Gene Names: MRPL59; PLINP1; PRG6; PLINP; PLINP-1

NCBI Description

This gene encodes a nuclear-localized protein that may be induced by p53 and regulates the cell cycle by inhibiting G1 to S phase progression. The encoded protein may interact with other cell cycle regulators. [provided by RefSeq, Aug 2012]

Uniprot Description

Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity. May play a role in mitochondrial protein synthesis.