Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD349 recombinant protein

CD349 Recombinant Protein

Gene Names
FZD9; FZD3; CD349
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD349; CD349 Recombinant Protein; CD349 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKD
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
633
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD349 recombinant protein
Background: Receptor for WNT2 that is coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Plays a role in neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin canonical signaling pathway. May play a role in neural progenitor cells (NPCs) viability through the beta-catenin canonical signaling pathway by negatively regulating cell cycle arrest leading to inhibition of neuron apoptotic process.During hippocampal development, regulates neuroblast proliferation and apoptotic cell death. Controls bone formation through non canonical Wnt signaling mediated via ISG15. Positively regulates bone regeneration through non canonical Wnt signaling (By similarity).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,466 Da
NCBI Official Full Name
frizzled-9
NCBI Official Synonym Full Names
frizzled family receptor 9
NCBI Official Symbol
FZD9
NCBI Official Synonym Symbols
FZD3; CD349
NCBI Protein Information
frizzled-9; fz-9; fzE6; hFz9; frizzled homolog 9; frizzled 9, seven transmembrane spanning receptor
UniProt Protein Name
Frizzled-9
UniProt Gene Name
FZD9
UniProt Synonym Gene Names
FZD3; Fz-9; hFz9
UniProt Entry Name
FZD9_HUMAN

NCBI Description

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney. [provided by RefSeq, Jul 2008]

Uniprot Description

FZD9: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, integral; GPCR, Fz/Smo family; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: filopodium membrane; cell surface; perinuclear region of cytoplasm; cytoplasm; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; protein homodimerization activity; protein heterodimerization activity

Biological Process: nervous system development; G-protein coupled receptor protein signaling pathway; learning and/or memory; B cell differentiation; neuroblast proliferation; Wnt receptor signaling pathway through beta-catenin

Research Articles on CD349

Similar Products

Product Notes

The CD349 fzd9 (Catalog #AAA3004282) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LEIGRFDPER GRGAAPCQAV EIPMCRGIGY NLTRMPNLLG HTSQGEAAAE LAEFAPLVQY GCHSHLRFFL CSLYAPMCTD QVSTPIPACR PMCEQARLRC APIMEQFNFG WPDSLDCARL PTRNDPHALC MEAPENATAG PAEPHKGLGM LPVAPRPARP PGDLGPGAGG SGTCENPEKF QYVEKSRSCA PRCGPGVEVF WSRRDKD. It is sometimes possible for the material contained within the vial of "CD349, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.