Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-7 (FZD7) Recombinant Protein | FZD7 recombinant protein

Recombinant Chicken Frizzled-7 (FZD7)

Gene Names
FZD7; Fz-7; cFz-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-7 (FZD7); Recombinant Chicken Frizzled-7 (FZD7); Recombinant Frizzled-7 (FZD7); Frizzled-7; Fz-7; cFz-7; FZD7 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-567
Sequence
AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV
Sequence Length
567
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,811 Da
NCBI Official Full Name
frizzled-7
NCBI Official Synonym Full Names
frizzled family receptor 7
NCBI Official Symbol
FZD7
NCBI Official Synonym Symbols
Fz-7; cFz-7
NCBI Protein Information
frizzled-7; frizzled homolog 7; frizzled 7, seven transmembrane spanning receptor
UniProt Protein Name
Frizzled-7
Protein Family
UniProt Gene Name
FZD7
UniProt Synonym Gene Names
FZ7; Fz-7; cFz-7
UniProt Entry Name
FZD7_CHICK

Uniprot Description

Function: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Subcellular location: Membrane; Multi-pass membrane protein

By similarity. Cell membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Expressed broadly in cranial ectoderm. Also expressed in the developing somites and in other cranial placodes, including the olfactory, lens, otic placodes (lateral half of the vesicle) and epibranchial placodes. Low level of expression in all the mesoderm derivatives in the limb buds.

Developmental stage: First detected as stage 6 in the forming neural tube and somites, but not in trunk surface ectoderm. By stage 8, expression persists in the cranial ectoderm and is up-regulated in the presomptive olfactory placodes. By stages 11-12, expression declines in the neural tube, but not in the cranial ectoderm; in somites, expressed all along the rostral-caudal axis as well as in presegmental mesenchyme caudal to the developing somites. Lens and otic placode expression first visible at stage 12, strongest at stages 13-16. Detected uniformly in ectoderm and mesenchyme of the limb primordia at stage 17. By stage 18, decrease of ectodermal, otic, lens and olfactory placode expression; expression appears in the epibranchial placodes. By stages 22-30, highest levels in the most distal mesoderm of the autopod, in the ventricular zone of the neural tube from the forebrain to the spinal cord, in the dermomyotomes and the tail buds.

Domain: Lys-Thr-X-X-X-Trp motif interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway

By similarity.The FZ domain is involved in binding with Wnt ligands

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.

Similar Products

Product Notes

The FZD7 fzd7 (Catalog #AAA1254911) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-567. The amino acid sequence is listed below: AHHEDKAISV PDHGFCQPIS IPLCTDIAYN QTILPNLLGH TNQEDAGLEV HQFYPLVKVQ CSAELKFFLC SMYAPVCTVL EQAIPPCRSL CERARQGCEA LMNKFGFQWP ERLRCENFPV HGAGEICVGQ NTSDAPPGPG GAGGRGATAQ PTAGYLPDLL TPPQPAAGFS FSCPRQLKVP PYLGYRFLGE RDCGAPCEPG RPNGLMYFKE AEVRFARLWV GVWSVLCCAS TLFTVLTYLV DMRRFSYPER PIIFLSGCYF MVAVAYAAGF LLEERVVCLE RFSEDGYRTV AQGTKKEGCT ILFMILYFFG MASSIWWVIL SLTWFLAAGM KWGHEAIEAN SQYFHLAAWA VPAVKTITIL AMGQVDGDVL SGVCYVGIYS VDSLRGFVLA PLFVYLFIGT SFLLAGFVSL FRIRTIMKHD GTKTEKLEKL MVRIGVFSVL YTVPATIVVA CYFYEQAFRS TWEKTWLLQT CKTYAVPCPS HFAPMSPDFT VFMIKYLMTM IVGITTGFWI WSGKTLQSWR RFYHRLSTGS KGETAV. It is sometimes possible for the material contained within the vial of "Frizzled-7 (FZD7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.