Frizzled-7 Recombinant Protein | FZD7 recombinant protein

Frizzled-7

Cat. Num. AAA7042780

• Gene Names: FZD7; Fz-7; cFz-7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Frizzled-7; FZD7 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 32-567aa; full length protein
• Sequence: AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV
• Sequence Length: Full Length Protein

• Species: Gallus gallus (Chicken)
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for FZD7 recombinant protein

This is a recombinant transmembrane protein expressed in a cell-free expression system.

Product Categories/Family for FZD7 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 46049081
• NCBI GeneID: 374060
• NCBI Accession #: NP_989552.1
• NCBI GenBank Nucleotide #: NM_204221.2
• UniProt Accession #: O57329; Q9IA04
• Molecular Weight: 62,811 Da
• NCBI Official Full Name: frizzled-7
• NCBI Official Synonym Full Names: frizzled class receptor 7
• NCBI Official Symbol: FZD7
• NCBI Official Synonym Symbols: Fz-7; cFz-7
• NCBI Protein Information: frizzled-7
• UniProt Protein Name: Frizzled-7
• Protein Family: Frizzled
• UniProt Gene Name: FZD7
• UniProt Synonym Gene Names: FZ7; Fz-7; cFz-7
• UniProt Entry Name: FZD7_CHICK

Uniprot Description

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.