Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-4 (Fzd4) Recombinant Protein | Fzd4 recombinant protein

Recombinant Rat Frizzled-4 (Fzd4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-4 (Fzd4); Recombinant Rat Frizzled-4 (Fzd4); Fzd4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
38-538aa; full length protein
Sequence
FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQF FLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNH MCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAK EFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVG RERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWG HEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQSLDALTGFVVAPLF TYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF YEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGK VKREKRGNGWVKPGKGNETVV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fzd4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,355 Da
NCBI Official Full Name
frizzled-4
NCBI Official Synonym Full Names
frizzled class receptor 4
NCBI Official Symbol
Fzd4
NCBI Protein Information
frizzled-4
UniProt Protein Name
Frizzled-4
UniProt Gene Name
Fzd4
UniProt Synonym Gene Names
Fz-4; rFz4
UniProt Entry Name
FZD4_RAT

NCBI Description

putative Wnt receptor; may play a role in the Wnt signaling pathway [RGD, Feb 2006]

Uniprot Description

FZD4: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Defects in FZD4 are the cause of vitreoretinopathy exudative type 1 (EVR1); also known as autosomal dominant familial exudative vitreoretinopathy (FEVR) or Criswick- Schepens syndrome. EVR1 is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. Clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease-related abnormality is an arc of avascular retina in the extreme temporal periphery. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, Fz/Smo family; Membrane protein, multi-pass

Cellular Component: cell surface; integral to membrane; intercellular junction; plasma membrane

Molecular Function: cytokine binding; G-protein coupled receptor activity; PDZ domain binding; protein heterodimerization activity; protein homodimerization activity; ubiquitin protein ligase binding; Wnt receptor activity; Wnt-protein binding

Biological Process: blood vessel development; G-protein coupled receptor protein signaling pathway; locomotion during locomotory behavior; luteinization; positive regulation of JNK activity; positive regulation of transcription factor activity; positive regulation of transcription, DNA-dependent; progesterone secretion; regulation of vascular endothelial growth factor receptor signaling pathway; sensory perception of sound; vasculogenesis; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin; Wnt receptor signaling pathway, calcium modulating pathway

Research Articles on Fzd4

Similar Products

Product Notes

The Fzd4 fzd4 (Catalog #AAA7015406) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-538aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fzd4 fzd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FGDEEERRCD PIRIAMCQNL GYNVTKMPNL VGHELQTDAE LQLTTFTPLI QYGCSSQLQF FLCSVYVPMC TEKINIPIGP CGGMCLSVKR RCEPVLKEFG FAWPDSLNCS KFPPQNDHNH MCMEGPGDEE VPLPHKTPIQ PGEECHSVGT NSDQYIWVKR SLNCVLKCGY DAGLYSRSAK EFTDIWMAVW ASLCFISTTF TVLTFLIDSS RFSYPERPII FLSMCYNIYS IAYIVRLTVG RERISCDFEE AAEPVLIQEG LKNTGCAIIF LLMYFFGMAS SIWWVILTLT WFLAAGLKWG HEAIEMHSSY FHIAAWAIPA VKTIVILIMR LVDADELTGL CYVGNQSLDA LTGFVVAPLF TYLVIGTLFI AAGLVALFKI RSNLQKDGTK TDKLERLMVK IGVFSVLYTV PATCVIACYF YEISNWALFR YSADDSNMAV EMLKIFMSLL VGITSGMWIW SAKTLHTWQK CSNRLVNSGK VKREKRGNGW VKPGKGNETV V. It is sometimes possible for the material contained within the vial of "Frizzled-4 (Fzd4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.