Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-3 (FZD3) Recombinant Protein | FZD3 recombinant protein

Recombinant Human Frizzled-3 (FZD3)

Gene Names
FZD3; Fz-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-3 (FZD3); Recombinant Human Frizzled-3 (FZD3); FZD3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-666aa; full length protein
Sequence
HSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLC ALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVD LNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFA RYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRV ACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSE AIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAPLCLY VVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYE QAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSVFWVGSKK TCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASS TQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSR HSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FZD3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
frizzled-3
NCBI Official Synonym Full Names
frizzled class receptor 3
NCBI Official Symbol
FZD3
NCBI Official Synonym Symbols
Fz-3
NCBI Protein Information
frizzled-3
UniProt Protein Name
Frizzled-3
UniProt Gene Name
FZD3
UniProt Synonym Gene Names
Fz-3; hFz3
UniProt Entry Name
FZD3_HUMAN

NCBI Description

This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. [provided by RefSeq, Dec 2010]

Uniprot Description

FZD3: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, Fz/Smo family; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: apical plasma membrane; axon; cell soma; cell surface; cytoplasm; dendrite; filopodium tip; integral to membrane; lateral plasma membrane; plasma membrane; presynaptic active zone

Molecular Function: G-protein coupled receptor activity; PDZ domain binding; protein binding; Wnt receptor activity; Wnt-protein binding

Biological Process: cell proliferation in midbrain; establishment of planar polarity; G-protein coupled receptor protein signaling pathway; hair follicle development; inner ear morphogenesis; negative regulation of mitotic cell cycle, embryonic; neural tube closure; neuron differentiation; neuron migration; positive regulation of neuroblast proliferation; Wnt receptor signaling pathway through beta-catenin; Wnt receptor signaling pathway, calcium modulating pathway; Wnt receptor signaling pathway, planar cell polarity pathway

Research Articles on FZD3

Similar Products

Product Notes

The FZD3 fzd3 (Catalog #AAA7015400) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-666aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FZD3 fzd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSLFSCEPIT LRMCQDLPYN TTFMPNLLNH YDQQTAALAM EPFHPMVNLD CSRDFRPFLC ALYAPICMEY GRVTLPCRRL CQRAYSECSK LMEMFGVPWP EDMECSRFPD CDEPYPRLVD LNLAGEPTEG APVAVQRDYG FWCPRELKID PDLGYSFLHV RDCSPPCPNM YFRREELSFA RYFIGLISII CLSATLFTFL TFLIDVTRFR YPERPIIFYA VCYMMVSLIF FIGFLLEDRV ACNASIPAQY KASTVTQGSH NKACTMLFMI LYFFTMAGSV WWVILTITWF LAAVPKWGSE AIEKKALLFH ASAWGIPGTL TIILLAMNKI EGDNISGVCF VGLYDVDALR YFVLAPLCLY VVVGVSLLLA GIISLNRVRI EIPLEKENQD KLVKFMIRIG VFSILYLVPL LVVIGCYFYE QAYRGIWETT WIQERCREYH IPCPYQVTQM SRPDLILFLM KYLMALIVGI PSVFWVGSKK TCFEWASFFH GRRKKEIVNE SRQVLQEPDF AQSLLRDPNT PIIRKSRGTS TQGTSTHASS TQLAMVDDQR SKAGSIHSKV SSYHGSLHRS RDGRYTPCSY RGMEERLPHG SMSRLTDHSR HSSSHRLNEQ SRHSSIRDLS NNPMTHITHG TSMNRVIEED GTSA. It is sometimes possible for the material contained within the vial of "Frizzled-3 (FZD3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.