Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-3 (fz3) Recombinant Protein | fz3 recombinant protein

Recombinant Drosophila melanogaster Frizzled-3 (fz3)

Gene Names
fz3; CG16785; dfz3; dFz3; Dfz3; DFz3; Dm Fz3; DmelCG16785; EG:34F3.6; Fz3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-3 (fz3); Recombinant Drosophila melanogaster Frizzled-3 (fz3); Recombinant Frizzled-3 (fz3); Frizzled-3; dFz3; fz3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-581
Sequence
ANGAGHNGPVASGAGPNGLQCQPIAVSACQGLGYNMTALPNLAGHTNQLEAELQIAKLVPLIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSFLNCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTSDLAGVLCPQNFSGSPFNPEECVPQCQRDAFHTSSQKKTSETLILGLSAVCFVLTLFALVTFWAEPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQARMHDVELQGRLMRPGCLLTPPCLASYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFHVLAWVPPLAPPIAALLLEKVRPSELTGMCYAPGFVELPALVLLLLGLYFTLRASRSLLSLQQQLQPTLAHHRFGQIRKRFVLFSLLYFAPTTAGVVAALCERYADSVPSCSTPDDCLSPTPLSAWPALVRIFFQLVGGTLTGLWVWSRKTCESYRNRLGASGTPTSSLMNQSKAAGALPKKHLYTSGKSMLPTGGITPLYAGISFHNVPVYNPNQSRV
Sequence Length
581
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63,252 Da
NCBI Official Full Name
frizzled 3, isoform A
NCBI Official Synonym Full Names
frizzled 3
NCBI Official Symbol
fz3
NCBI Official Synonym Symbols
CG16785; dfz3; dFz3; Dfz3; DFz3; Dm Fz3; DmelCG16785; EG:34F3.6; Fz3
NCBI Protein Information
CG16785 gene product from transcript CG16785-RA; CG16785-PA; CG16785-PB; Dfrizzled-3; frizzled 3; fz3-PA; fz3-PB
UniProt Protein Name
Frizzled-3
Protein Family
UniProt Gene Name
fz3
UniProt Synonym Gene Names
dFz3
UniProt Entry Name
FRIZ3_DROME

Uniprot Description

Function: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Required to coordinate the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles. Ref.1 Ref.2

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Wing, leg and eye imaginal disks. In embryos, expressed is seen in brain, proventriculus, Malpighian tubules, anal plate and visceral mesoderm of parasegment 8.

Developmental stage: Expressed in embryos from stage 11 and in larvae.

Domain: The FZ domain is involved in binding with Wnt ligands

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.

Sequence caution: The sequence CAA20896.1 differs from that shown. Reason: Erroneous gene model prediction.

Similar Products

Product Notes

The fz3 fz3 (Catalog #AAA1127229) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-581. The amino acid sequence is listed below: ANGAGHNGPV ASGAGPNGLQ CQPIAVSACQ GLGYNMTALP NLAGHTNQLE AELQIAKLVP LIESGCSRRA RFLLCSSLFP LCTPDVPRPV AACKLLCETV RGECMENAPP ELMELWPSFL NCDGLPQPEK HELCMQIPQE VAVPGGSPSG PPTTGSPGVE DHPQTYRFWK SGASPTSDLA GVLCPQNFSG SPFNPEECVP QCQRDAFHTS SQKKTSETLI LGLSAVCFVL TLFALVTFWA EPTRFGYPER PVLFLCLCYN LFSVCYLERI VFHNQARMHD VELQGRLMRP GCLLTPPCLA SYITTSYLSL CAASWWLIFA LCFYLSSHKK WSSEALEKRS GLFHVLAWVP PLAPPIAALL LEKVRPSELT GMCYAPGFVE LPALVLLLLG LYFTLRASRS LLSLQQQLQP TLAHHRFGQI RKRFVLFSLL YFAPTTAGVV AALCERYADS VPSCSTPDDC LSPTPLSAWP ALVRIFFQLV GGTLTGLWVW SRKTCESYRN RLGASGTPTS SLMNQSKAAG ALPKKHLYTS GKSMLPTGGI TPLYAGISFH NVPVYNPNQS RV. It is sometimes possible for the material contained within the vial of "Frizzled-3 (fz3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.