Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FXYD domain-containing ion transport regulator 7 (Fxyd7) Recombinant Protein | Fxyd7 recombinant protein

Recombinant Rat FXYD domain-containing ion transport regulator 7 (Fxyd7)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FXYD domain-containing ion transport regulator 7 (Fxyd7); Recombinant Rat FXYD domain-containing ion transport regulator 7 (Fxyd7); Recombinant FXYD domain-containing ion transport regulator 7 (Fxyd7); FXYD domain-containing ion transport regulator 7; Fxyd7 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-80
Sequence
MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIIISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV
Sequence Length
80
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,487 Da
NCBI Official Full Name
FXYD domain-containing ion transport regulator 7
NCBI Official Synonym Full Names
FXYD domain-containing ion transport regulator 7
NCBI Official Symbol
Fxyd7
NCBI Protein Information
FXYD domain-containing ion transport regulator 7
UniProt Protein Name
FXYD domain-containing ion transport regulator 7
UniProt Gene Name
Fxyd7
UniProt Entry Name
FXYD7_RAT

NCBI Description

This reference sequence was derived from multiple ESTs and validated by similar mouse cDNA and human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., [email protected]., Dec 2000]

Uniprot Description

FXYD7: This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., [email protected]., Dec 2000]

Protein type: Membrane protein, integral

Cellular Component: integral to membrane

Molecular Function: ion channel activity; ATPase binding

Biological Process: regulation of ion transport

Research Articles on Fxyd7

Similar Products

Product Notes

The Fxyd7 fxyd7 (Catalog #AAA951560) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-80. The amino acid sequence is listed below: MATPTQSPTN VPEETDPFFY DYATVQTVGM TLATIMFVLG IIIIISKKVK CRKADSRSES PTCKSCKSEL PSSAPGGGGV. It is sometimes possible for the material contained within the vial of "FXYD domain-containing ion transport regulator 7 (Fxyd7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.