Furin-like protease 1, isoform 1-CRR (Fur1) Recombinant Protein | Fur1 recombinant protein
Recombinant Drosophila melanogaster Furin-like protease 1, isoform 1-CRR (Fur1)
Gene Names
Fur1; CG10772; dFur1; Dfur1; dFurin 1; Dfurin1; dKLIP-1; DmelCG10772; fur-1; fur1; furin; Furin; Furl; fur[1]; Klip1; l(3)rL205
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Furin-like protease 1; isoform 1-CRR (Fur1); Recombinant Drosophila melanogaster Furin-like protease 1; Fur1 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
310-1101aa; full length protein
Sequence
DFIRMRPSRTSSRAMSMVDAMSFNDSKWPQMWYLNRGGGLDMNVIPAWKMGITGKGVVVT ILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANNSF CAVGIAYGASVGGVRMLDGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVDGPGELA SRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHVPWYS EKCSSTLATTYSSGGQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGIAALVLQSNQNLTW RDLQHIVVRTAKPANLKDPSWSRNGVGRRVSHSFGYGLMDAAEMVRVARNWKAVPEQQRC EINAPHVDKVIPPRTHITLQLTVNHCRSVNYLEHVQAKITLTSQRRGDIQLFLRSPANTS VTLLTPRIHDNSRSGFNQWPFMSVHTWGESPQGNWQLEIHNEGRYMAQITQWDMIFYGTE TPAQPDDVANPSQSNQFNLYGNDMAHNDVEYDSTGQWRNMQQVGEVGMTRDHSNTAACLK WSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDKFQAEEDEQDDEVTRGPVNPYSSSPMDH SLLMSNSLDDKQDPLQAEDRRRRSSLTQLVEVPSRVCAACDRSCLECYGALASQCSTCSP GSQLRKILNETFCYAYVVRSTGMASVVDISKMDDRDTQQYMTGTTVLLLVSVIFTLMGVA VAGGIVYHRRAMARSNELYSRVSLVPGDESDSDEDELFTAHFPARKSGVNIYRDEAPSEK IFEEDEISHLVP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fur1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
98,797 Da
NCBI Official Full Name
furin 1, isoform A
NCBI Official Synonym Full Names
Furin 1
NCBI Official Symbol
Fur1
NCBI Official Synonym Symbols
CG10772; dFur1; Dfur1; dFurin 1; Dfurin1; dKLIP-1; DmelCG10772; fur-1; fur1; furin; Furin; Furl; fur[1]; Klip1; l(3)rL205
NCBI Protein Information
CG10772 gene product from transcript CG10772-RA
UniProt Protein Name
Furin-like protease 1, isoform 1-CRR
Protein Family
UniProt Gene Name
Fur1
UniProt Synonym Gene Names
Furin-1
UniProt Entry Name
FUR1C_DROME
Uniprot Description
Furin is likely to represent the ubiquitous endoprotease activity within constitutive secretory pathways and capable of cleavage at the RX(K/R)R consensus motif.
Research Articles on Fur1
Similar Products
Product Notes
The Fur1 fur1 (Catalog #AAA7015364) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 310-1101aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fur1 fur1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DFIRMRPSRT SSRAMSMVDA MSFNDSKWPQ MWYLNRGGGL DMNVIPAWKM GITGKGVVVT ILDDGLESDH PDIQDNYDPK ASYDVNSHDD DPMPHYDMTD SNRHGTRCAG EVAATANNSF CAVGIAYGAS VGGVRMLDGD VTDAVEARSL SLNPQHIDIY SASWGPDDDG KTVDGPGELA SRAFIEGTTK GRGGKGSIFI WASGNGGREQ DNCNCDGYTN SIWTLSISSA TEEGHVPWYS EKCSSTLATT YSSGGQGEKQ VVTTDLHHSC TVSHTGTSAS APLAAGIAAL VLQSNQNLTW RDLQHIVVRT AKPANLKDPS WSRNGVGRRV SHSFGYGLMD AAEMVRVARN WKAVPEQQRC EINAPHVDKV IPPRTHITLQ LTVNHCRSVN YLEHVQAKIT LTSQRRGDIQ LFLRSPANTS VTLLTPRIHD NSRSGFNQWP FMSVHTWGES PQGNWQLEIH NEGRYMAQIT QWDMIFYGTE TPAQPDDVAN PSQSNQFNLY GNDMAHNDVE YDSTGQWRNM QQVGEVGMTR DHSNTAACLK WSDRKCLECN DSAYMFEDQC YDVCPVHTYP LDKFQAEEDE QDDEVTRGPV NPYSSSPMDH SLLMSNSLDD KQDPLQAEDR RRRSSLTQLV EVPSRVCAAC DRSCLECYGA LASQCSTCSP GSQLRKILNE TFCYAYVVRS TGMASVVDIS KMDDRDTQQY MTGTTVLLLV SVIFTLMGVA VAGGIVYHRR AMARSNELYS RVSLVPGDES DSDEDELFTA HFPARKSGVN IYRDEAPSEK IFEEDEISHL VP. It is sometimes possible for the material contained within the vial of "Furin-like protease 1, isoform 1-CRR (Fur1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
